Viesearch
Join Now  Sign In  
Viesearch - Human Powered Search Engine
596,837,660 Searches  3,395,320 Submissions  861,136 Sites  4,934 Featured  1,083 Categories  330,239 Editors
Arts and Entertainment (79,200)
Animation, Architecture, Art History, 29 More...
Animation, Architecture, Art History, Astrology and Horoscopes, Body Modification, Classical Studies, Comics, Crafts, Dance, Design, Entertainment, Fashion, Graphic Design, Humanities, Humor, Illustration, Literature, Movies, Music, Myths and Folktales, Native and Tribal, Online Writing, Performing Arts, Photography, Radio, Rhetoric, Television, Theatre, Typography, Video, Visual Arts, Writers Resources
Business (97,543)
Agriculture, Bookkeeping and Accounting, Construction, 31 More...
Agriculture, Bookkeeping and Accounting, Construction, Consulting, Cooperatives, Customer Service, Engineering, Event Planning, Freight Brokerage and Transportation, Human Resources, Industrial, Information Services, International Business and Trade, Life Coaching, Locksmiths, Major Companies, Management, Manufacturing, Messengers and Couriers, Mining, Opportunities, Outsourcing, Painting Services, Personal and Virtual Assistants, Point of Sale Hardware and Systems, Private Investigation, Publishing and Printing, Security Services, Small Business, Telecommunications, Transcription Services, Translation Services, Waste Management and Recycling, Work At Home
Computers and Internet (88,400)
Algorithms, Artificial Intelligence, Chats and Forums, 29 More...
Algorithms, Artificial Intelligence, Chats and Forums, Computer Repair, Computer Science, Cyberculture, Data Backup, Data Recovery, Desktop and Mobile Wallpapers, Desktop Publishing, Domain Names, E-Commerce, Freelancers, Hardware, Internet, Mobile Computing, Open Source, Operating Systems, Podcasts, Portal, Programming, Robotics, Search Engines, Security, Social Networking, Software, Systems, Technical Guides and Support, Virtual Reality, Web Design and Development, Web Hosting, Webmaster Resources
Games (7,413)
Board Games, Card Games, Coin-Op, 17 More...
Board Games, Card Games, Coin-Op, Computer Games, Dice, Flash Game Arcades, Hand Games, Hand-Eye Coordination, Miniatures, Mobile Games, Online, Paper and Pencil, Party Games, Play-By-Mail, Puzzles, Roleplaying, Tile Games, Trading Card Games, Video Games, Yard, Deck, and Table Games
Health and Fitness (72,508)
Aging, Allergies, Alternative, 45 More...
Aging, Allergies, Alternative, Anaesthesiology, Animal, Ayurveda, Beauty, Cardiology, Child Health, Chiropractic, Clinical Research, Conditions and Diseases, Cosmetic Surgery, Dental, Dermatology, Diagnostic Imaging, Disabilities, DNA Testing, First Aid, Fitness, Healthcare Industry, Hearing and Audiology, Home Health Care, Homeopathy, Hygiene, Massage Therapy, Medical Billing, Medical Equipment, Medical ID Bracelets, Medicine, Mental Health, Nephrology, Neurology, Nursing, Nutrition, Obstetrics and Gynecology, Oncology, Ophthalmology and Optometry, Orthopedics, Otorhinolaryngology, Pain Management, Physical Therapy, Physiotherapy, Podiatry, Rheumatology, Senior Care, Urology, Weight Loss
Home (110,702)
Apartment Living, Appliance Repair, Asbestos Removal, 42 More...
Apartment Living, Appliance Repair, Asbestos Removal, Bathroom, Carpeting and Flooring, Chimney Cleaning, Cleaning Services, Cooking, Do-It-Yourself, Domestic Services, Electricians, Emergency Preparation, Entertaining, Family, Fences, Furniture, Garage, Heating and Cooling, Home and Office Safety, Home Automation, Home Business, Home Improvement, Home Restoration and Repair, Homemaking, Homeowners, Interior Design, Kitchen, Laundry and Dry Cleaning, Lighting, Packers and Movers, Personal Finance, Personal Organization, Pest Control, Pets, Plumbing, Roofs and Gutters, Rural Living, Security, Seniors, Storage, Swimming Pools and Spas, Tree Cutting and Removal, Urban Living, Windows and Siding, Yard and Garden
Jobs and Employment (6,079)
Accountancy, Administration, Airport, 21 More...
Accountancy, Administration, Airport, Background Screening, Banking, Call Center, Civil Service, Construction, Customer Service, Driving, Fashion Design, Finance, Hospitality, Marketing, Office, Online Jobs, Part Time, Recruitment Agencies, Resume Writing, Retail, Sales, Teaching, Teaching Assistant, Warehouse
Kids and Teens (7,260)
Arts, Babies, Childcare, 6 More...
Arts, Babies, Childcare, People and Society, Pre-School, School Time, Sports and Hobbies, Teen Life, Your Family
Marketing and Advertising (32,669)
Agencies, Banner Exchange, Directories, 12 More...
Agencies, Banner Exchange, Directories, Forum Posting Services, Link Building, Magazine, Newspaper, Outdoor, Pay Per Click, Promotional Products, Search Engine Optimization, Signage, Television, Trade Show Displays, Traffic Exchange
News (19,902)
Current Events, Internet Broadcasts, Journals, 4 More...
Current Events, Internet Broadcasts, Journals, Magazines and E-zines, Newspapers, Television, Weather
Real Estate (29,166)
Apartment Rentals, Appraisers and Consultants, Brokerages, 10 More...
Apartment Rentals, Appraisers and Consultants, Brokerages, Commercial, Coworking and Office Space, Farm Land, For Sale By Owner, Home Inspection, Plots and Land For Sale, Property Management, Realtors, Residential Projects, Timeshare
Reference and Education (77,607)
Advice, Almanacs, Articles, 17 More...
Advice, Almanacs, Articles, Bibliography, Biography, Blogs, College and University, Education and Training, Educational Resources, Encyclopedias, Genealogy, History, Knowledge Management, Libraries, Living History, Maps, Museums, Resources, Thesauri, World Records
Regional (21,554)
Africa, Argentina, Armenia, 39 More...
Africa, Argentina, Armenia, Asia, Australia, Austria, Brazil, Canada, Caribbean, Central America, Croatia, Czech Republic, Denmark, Europe, Finland, Germany, Greece, Hong Kong, India, Indonesia, Ireland, Israel, Italy, Japan, Lithuania, Middle East, Netherlands, New Zealand, North America, Norway, Oceania, Philippines, Polar Regions, Puerto Rico, Russia, Slovakia, South America, Sweden, Taiwan, United Kingdom, United States, Zimbabwe
Science (9,037)
Aerospace and Aeronautics, Astronomy, Biology, 19 More...
Aerospace and Aeronautics, Astronomy, Biology, Chemistry, Conferences, Earth Sciences, Environment and Nature, Geology and Geophysics, Institutions, Instruments and Supplies, Mathematics, Methods and Techniques, Museums, Nanotechnology, News and Media, Physics, Publications, Reference, Renewable Energy, Science in Society, Technology, Wildlife
Shopping (105,425)
Antiques, Appliances, Art Supplies, 22 More...
Antiques, Appliances, Art Supplies, Auctions, Autos, Beauty Products, Books, Classifieds, Clothing and Shoes, Coupons and Deals, Electronics, Flowers, Food and Beverage, Gifts, Glassware, Greeting Cards, Jewelry, Mobile Phones, Motorcycles, Office Products, Sporting Goods, Tickets, Tools and Hardware, Toys, Wholesale
Society (30,631)
Activism, Crime, Death, 26 More...
Activism, Crime, Death, Disabled, Economics, Ethnicity, Folklore, Future, Holidays, Issues, Language and Linguistics, Law, Lifestyle Choices, Men, Military, Organizations, Paranormal, People, Philanthropy, Philosophy, Roads and Highways, Social Sciences, Sociology, Subcultures, Support Groups, Trains and Railroads, Urban Legends, Weddings, Women
Sports and Recreation (24,752)
Archery, Audio and Radio, Aviation, 55 More...
Archery, Audio and Radio, Aviation, Badminton, Baseball, Basketball, Billiards, Birding, Boating, Bowling, Boxing and MMA, Camps, Climbing, Coaching, Collecting, Crafts, Cricket, Cycling, Disabled, Events, Extreme Sports, Fantasy, Fishing, Football, Geocaching, Golf, Hang Gliding, Hockey, Horseracing, Kites, Knives, Lacrosse, Martial Arts, Models, Motorsports, Organizations, Outdoors, Paintball, Parties, People, Rugby, Running, Scouting, Scuba Diving, Skateboarding, Skating, Soccer, Surfing, Swimming, Table Tennis, Team Spirit, Tennis, Theme Parks, Track and Field, Volleyball, Weight Lifting, Winter Sports, Wrestling
Travel (41,288)
Aircraft Charter, Cruises, Hotels and Accomodation, 7 More...
Aircraft Charter, Cruises, Hotels and Accomodation, Limousines, Luggage, Taxis and Chauffeurs, Tours, Travel Agents, Vacation Packages, Vehicle Rental
Currently TrendingMore...
Recent Searches
Newest Featured
Add a site
Healthcare Marketing Agency in London - Healthcare Marketing Agency in London. Helping medical clinics in SEO, PPC, Social Media and more.
Healthcare Marketing Agency in London
Healthcare Marketing Agency in London. Helping medical clinics in SEO, PPC, Social Media and more.
https://smtdigital.co.uk Marketing and Advertising - More Details
Total Locker Service - Free UK delivery on all our storage solutions, massive range of locker locks and parts. School storage and metal storage solutions are available on a 5-day delivery.
Total Locker Service
Free UK delivery on all our storage solutions, massive range of locker locks and parts. School storage and metal storage solutions are available on a 5-day delivery.
https://total-locker-service.com/ Shopping, Office Products - More Details
MATERNITY AND NEWBORN PHOTOGRAPHY - Professional maternity, newborn, cake smash and family photography in Toronto
MATERNITY AND NEWBORN PHOTOGRAPHY
Professional maternity, newborn, cake smash and family photography in Toronto
https://maternityandnewborn.com/ Arts and Entertainment, Photography, Photographers - More Details
Window & Door Supplier - Colin's Sash Windows is best known for disrupting the upvc sash window market in the UK in 2014 by introducing affordable fixed prices for upvc sash windows in the UK. Before this they were generally only available at very high prices through window installers. Today they are market leaders in cheaper alternatives to the renowned steel Crittall interior and exterior windows and doors.
Window & Door Supplier
Colin's Sash Windows is best known for disrupting the upvc sash window market in the UK in 2014 by introducing affordable fixed prices for upvc sash windows in the UK. Before this they were generally only available at very high prices through window installers. Today they are market leaders in cheaper alternatives to the renowned steel Crittall interior and exterior windows...
https://colinssashwindows.co.uk/ Home, Windows and Siding - More Details
agencecybele.fr - Cybèle Agency in Mérignac, near Bordeaux. Specializing in custom website creation, WordPress CMS, and SEO.
agencecybele.fr
Cybèle Agency in Mérignac, near Bordeaux. Specializing in custom website creation, WordPress CMS, and SEO.
https://agencecybele.fr/ Computers and Internet, Web Design and Development - More Details
Recent social activity
View more
Scintilla Kreations submitted a new listing
Wednesday, June 26th, 2024 at 12:49am
Kris Cooper joined the team as a Viesearch editor!
Pet Boarding in Kasilof, AK
Wednesday, June 26th, 2024 at 12:48am
Akshay submitted a new listing and activated a new listing for Crossbody Luxury Bags, Clutch Purse For Women
Wednesday, June 26th, 2024 at 12:42am
PartsFe activated a new listing and tagged Blodgett 3583 Center Deflector | PartsFe
3583 grates and radiantsblodgett 35833583 center deflector
Wednesday, June 26th, 2024 at 12:39am
JosephUSA submitted a new listing
Wednesday, June 26th, 2024 at 12:36am
Recently Viewed Listings
Buy kishmish online of the best quality at Farmonics - When you buy Farmonics raisins, you can be confident that they will be of dependably high quality. Because of the quality packaging, Farmonics Raisins remain tasty and delicious. Every box contains delectable dried fruit that is lengthy in size. Because it contains potassium, it aids in maintaining normal blood pressure. Dry fruits and nuts are considered healthier snack alternatives. Use it as a holiday gift basket or a tasty snack on a daily basis. Three-layer packaging extends the shelf lifeThe Sweet Spot MD - The Sweet Spot MD is a catering and event planning company with a focus on custom cakes and specialty desserts. We service individuals, businesses, private events, and nonprofit clients in the Washington, DC Metro area and surrounding towns. Contact us for your next event, so we can help you create delicious memories! We offer the following services: Event Staffing Food and Beverage Service Custom Cakes and Specialty Desserts Event Planning and Management Centerpiece and Floral ArRoot Canal Specialist in Chennai - Root Canal Foundation is the best dental clinic in Chennai offering exceptional quality Root Canal Treatment. This is the campaign of expert Root Canal Specialists in Chennai. Having modern technologies in Dentistry, we are offering high quality, advanced endodontic treatments.Laser Hair Removal - Atlanta, GA | Blue Divine, Inc. - Blue Divine, Inc. Offers Laser Hair Removal in Atlanta, GA with Guaranteed Permanent Hair Reduction using our industry leading Nd: YAG Cynosure Lasers.Staffing solutions | permanent recruitment ageny - Experts with an excellent professional staffing agency and staffing solutions for selecting the right candidates. A very reliable source to fulfill your dream job. call us @ 022 4054 9797.
Food Chemistry, Processed Foods & Toxicology - FoodChem Toxicology 2019 inviting all the participants globally to the upcoming Philippines Meetings on Food Chemistry, Processed foods and Toxicology 29-30 November, Manila, Philippines.The Hub of Premium Leather Products - Maruti Suzuki ARENA Car Showroom at Mettugadda - Sri Jayarama Motors - Sri Jayarama Motors is an exclusive car dealership in Mahbubnagar. Get amazing car offers with our wide range of Maruti Suzuki ARENA cars including S-Presso, Celerio, Celerio X, Alto, Ertiga, Dzire, Swift, Alto K10, Eeco and WagonR. You can book a test drive or get an quote online by visiting our website. Visit to our exclusive showroom at Mettugadda in Mahbubnagar to know more!ISO 14001 Certification -Morocco - IAS is providing one of the most comprehensive programs of ISO 14001 certification service in Nigeria. We assist the organizations to plan, design, implement, monitor, control, improve and enhance persistently their performances and achieve ISO certification for eco-friendly companies.Best Orthodontic treatment in Manhattan - Best Orthodontic treatment in Manhattan which Provides Braces and Invisalign treatment to all age groups. please contact us and know more treatment details
Recently Active Editors
zamorinandgamadoctorchawlasmart001bankingfinancecrowdfunding12
alexpetermbcarwenardysishakhanfirststepsaubhansalitechno
Random Editor

Comfort Massage Spa Molino
Top Featured
Add a site
Antisan Yacht - Antisan is 33m motor yacht based in Cannes in the south of France. The yacht is available to charter by the day, week or longer. Antisan sleeps up to 11 guests in 5 cabins. The yacht has a fabulous crew, including an amazing Chef. Unlike other charter yachts, Antisan is not limited to 12 guests when cruising. She is legally allowed to cruise in daylight hours with up to 40 people onboard. This makes Antisan the ideal yacht for day charters for large groups, as well as weddings and...
Antisan Yacht
Antisan is 33m motor yacht based in Cannes in the south of France. The yacht is available to charter by the day, week or longer. Antisan sleeps up to 11 guests in 5 cabins. The yacht has a fabulous crew, including an amazing Chef. Unlike other charter yachts, Antisan is not limited to 12 guests when cruising. She is legally allowed to cruise in daylight hours with up to...
https://bespokeyachtcharter.com/antisan/
Expires on Monday, February 8th, 2044 Sports and Recreation, Boating - More Details
Madison Liquidators - Looking for office furniture for your business or home? Check out Madison Liquidators for an extensive collection of office chairs, desks, conference tables, file cabinets, and much more. Enjoy the convenience of direct shipping to your doorstep.
Madison Liquidators
Looking for office furniture for your business or home? Check out Madison Liquidators for an extensive collection of office chairs, desks, conference tables, file cabinets, and much more. Enjoy the convenience of direct shipping to your doorstep.
https://madisonliquidators.com/
Expires on Tuesday, July 22nd, 2042 Home, Furniture - More Details
MMA Podcast | Coupons - Welcome to our MMA podcast based in Chicago, where we explore the fine line between serious and ridiculous. Join us as we delve into the world of mixed martial arts and share our unique insights and perspectives.
MMA Podcast | Coupons
Welcome to our MMA podcast based in Chicago, where we explore the fine line between serious and ridiculous. Join us as we delve into the world of mixed martial arts and share our unique insights and perspectives.
http://mmanuts.com/
Expires on Saturday, July 27th, 2041 Sports and Recreation, Boxing and MMA - More Details
Comfyhome Heating & Cooling Melbourne - Comfyhome Specialised in gas ducted heating, evaporative cooling, split system and air conditioning installation, service and repairs. ComfyHome adheres to a customer-centric approach in a bid to provide premium heating and cooling solutions that fulfill your needs and align with your budget. We bring you convenience, affordability, and quality of service you won't find anywhere else.
Comfyhome Heating & Cooling Melbourne
Comfyhome Specialised in gas ducted heating, evaporative cooling, split system and air conditioning installation, service and repairs. ComfyHome adheres to a customer-centric approach in a bid to provide premium heating and cooling solutions that fulfill your needs and align with your budget. We bring you convenience, affordability, and quality of service you won't find...
https://www.comfyhome.com.au
Expires on Friday, July 12th, 2041 Home, Heating and Cooling - More Details
Office Furniture - Madison Liquidators is a nationwide distributor of new performance laminate, veneer and solid wood office furniture. Visit us for great deals at liquidation prices!
Office Furniture
Madison Liquidators is a nationwide distributor of new performance laminate, veneer and solid wood office furniture. Visit us for great deals at liquidation prices!
https://www.madisonliquidators.com/office-furniture/
Expires on Wednesday, May 15th, 2041 Home, Furniture - More Details
© 2004-2024 Viesearch. 16 Hudson Ave #3201, Glens Falls, NY 12801   Auctions   Terms   Privacy   RSS