Viesearch
Join Now  Sign In  
Viesearch - Human Powered Search Engine
596,825,399 Searches  3,395,275 Submissions  861,134 Sites  4,934 Featured  1,083 Categories  330,242 Editors
Arts and Entertainment (79,202)
Animation, Architecture, Art History, 29 More...
Animation, Architecture, Art History, Astrology and Horoscopes, Body Modification, Classical Studies, Comics, Crafts, Dance, Design, Entertainment, Fashion, Graphic Design, Humanities, Humor, Illustration, Literature, Movies, Music, Myths and Folktales, Native and Tribal, Online Writing, Performing Arts, Photography, Radio, Rhetoric, Television, Theatre, Typography, Video, Visual Arts, Writers Resources
Business (97,540)
Agriculture, Bookkeeping and Accounting, Construction, 31 More...
Agriculture, Bookkeeping and Accounting, Construction, Consulting, Cooperatives, Customer Service, Engineering, Event Planning, Freight Brokerage and Transportation, Human Resources, Industrial, Information Services, International Business and Trade, Life Coaching, Locksmiths, Major Companies, Management, Manufacturing, Messengers and Couriers, Mining, Opportunities, Outsourcing, Painting Services, Personal and Virtual Assistants, Point of Sale Hardware and Systems, Private Investigation, Publishing and Printing, Security Services, Small Business, Telecommunications, Transcription Services, Translation Services, Waste Management and Recycling, Work At Home
Computers and Internet (88,399)
Algorithms, Artificial Intelligence, Chats and Forums, 29 More...
Algorithms, Artificial Intelligence, Chats and Forums, Computer Repair, Computer Science, Cyberculture, Data Backup, Data Recovery, Desktop and Mobile Wallpapers, Desktop Publishing, Domain Names, E-Commerce, Freelancers, Hardware, Internet, Mobile Computing, Open Source, Operating Systems, Podcasts, Portal, Programming, Robotics, Search Engines, Security, Social Networking, Software, Systems, Technical Guides and Support, Virtual Reality, Web Design and Development, Web Hosting, Webmaster Resources
Games (7,413)
Board Games, Card Games, Coin-Op, 17 More...
Board Games, Card Games, Coin-Op, Computer Games, Dice, Flash Game Arcades, Hand Games, Hand-Eye Coordination, Miniatures, Mobile Games, Online, Paper and Pencil, Party Games, Play-By-Mail, Puzzles, Roleplaying, Tile Games, Trading Card Games, Video Games, Yard, Deck, and Table Games
Health and Fitness (72,505)
Aging, Allergies, Alternative, 45 More...
Aging, Allergies, Alternative, Anaesthesiology, Animal, Ayurveda, Beauty, Cardiology, Child Health, Chiropractic, Clinical Research, Conditions and Diseases, Cosmetic Surgery, Dental, Dermatology, Diagnostic Imaging, Disabilities, DNA Testing, First Aid, Fitness, Healthcare Industry, Hearing and Audiology, Home Health Care, Homeopathy, Hygiene, Massage Therapy, Medical Billing, Medical Equipment, Medical ID Bracelets, Medicine, Mental Health, Nephrology, Neurology, Nursing, Nutrition, Obstetrics and Gynecology, Oncology, Ophthalmology and Optometry, Orthopedics, Otorhinolaryngology, Pain Management, Physical Therapy, Physiotherapy, Podiatry, Rheumatology, Senior Care, Urology, Weight Loss
Home (110,700)
Apartment Living, Appliance Repair, Asbestos Removal, 42 More...
Apartment Living, Appliance Repair, Asbestos Removal, Bathroom, Carpeting and Flooring, Chimney Cleaning, Cleaning Services, Cooking, Do-It-Yourself, Domestic Services, Electricians, Emergency Preparation, Entertaining, Family, Fences, Furniture, Garage, Heating and Cooling, Home and Office Safety, Home Automation, Home Business, Home Improvement, Home Restoration and Repair, Homemaking, Homeowners, Interior Design, Kitchen, Laundry and Dry Cleaning, Lighting, Packers and Movers, Personal Finance, Personal Organization, Pest Control, Pets, Plumbing, Roofs and Gutters, Rural Living, Security, Seniors, Storage, Swimming Pools and Spas, Tree Cutting and Removal, Urban Living, Windows and Siding, Yard and Garden
Jobs and Employment (6,078)
Accountancy, Administration, Airport, 21 More...
Accountancy, Administration, Airport, Background Screening, Banking, Call Center, Civil Service, Construction, Customer Service, Driving, Fashion Design, Finance, Hospitality, Marketing, Office, Online Jobs, Part Time, Recruitment Agencies, Resume Writing, Retail, Sales, Teaching, Teaching Assistant, Warehouse
Kids and Teens (7,260)
Arts, Babies, Childcare, 6 More...
Arts, Babies, Childcare, People and Society, Pre-School, School Time, Sports and Hobbies, Teen Life, Your Family
Marketing and Advertising (32,670)
Agencies, Banner Exchange, Directories, 12 More...
Agencies, Banner Exchange, Directories, Forum Posting Services, Link Building, Magazine, Newspaper, Outdoor, Pay Per Click, Promotional Products, Search Engine Optimization, Signage, Television, Trade Show Displays, Traffic Exchange
News (19,905)
Current Events, Internet Broadcasts, Journals, 4 More...
Current Events, Internet Broadcasts, Journals, Magazines and E-zines, Newspapers, Television, Weather
Real Estate (29,167)
Apartment Rentals, Appraisers and Consultants, Brokerages, 10 More...
Apartment Rentals, Appraisers and Consultants, Brokerages, Commercial, Coworking and Office Space, Farm Land, For Sale By Owner, Home Inspection, Plots and Land For Sale, Property Management, Realtors, Residential Projects, Timeshare
Reference and Education (77,606)
Advice, Almanacs, Articles, 17 More...
Advice, Almanacs, Articles, Bibliography, Biography, Blogs, College and University, Education and Training, Educational Resources, Encyclopedias, Genealogy, History, Knowledge Management, Libraries, Living History, Maps, Museums, Resources, Thesauri, World Records
Regional (21,555)
Africa, Argentina, Armenia, 39 More...
Africa, Argentina, Armenia, Asia, Australia, Austria, Brazil, Canada, Caribbean, Central America, Croatia, Czech Republic, Denmark, Europe, Finland, Germany, Greece, Hong Kong, India, Indonesia, Ireland, Israel, Italy, Japan, Lithuania, Middle East, Netherlands, New Zealand, North America, Norway, Oceania, Philippines, Polar Regions, Puerto Rico, Russia, Slovakia, South America, Sweden, Taiwan, United Kingdom, United States, Zimbabwe
Science (9,036)
Aerospace and Aeronautics, Astronomy, Biology, 19 More...
Aerospace and Aeronautics, Astronomy, Biology, Chemistry, Conferences, Earth Sciences, Environment and Nature, Geology and Geophysics, Institutions, Instruments and Supplies, Mathematics, Methods and Techniques, Museums, Nanotechnology, News and Media, Physics, Publications, Reference, Renewable Energy, Science in Society, Technology, Wildlife
Shopping (105,426)
Antiques, Appliances, Art Supplies, 22 More...
Antiques, Appliances, Art Supplies, Auctions, Autos, Beauty Products, Books, Classifieds, Clothing and Shoes, Coupons and Deals, Electronics, Flowers, Food and Beverage, Gifts, Glassware, Greeting Cards, Jewelry, Mobile Phones, Motorcycles, Office Products, Sporting Goods, Tickets, Tools and Hardware, Toys, Wholesale
Society (30,633)
Activism, Crime, Death, 26 More...
Activism, Crime, Death, Disabled, Economics, Ethnicity, Folklore, Future, Holidays, Issues, Language and Linguistics, Law, Lifestyle Choices, Men, Military, Organizations, Paranormal, People, Philanthropy, Philosophy, Roads and Highways, Social Sciences, Sociology, Subcultures, Support Groups, Trains and Railroads, Urban Legends, Weddings, Women
Sports and Recreation (24,752)
Archery, Audio and Radio, Aviation, 55 More...
Archery, Audio and Radio, Aviation, Badminton, Baseball, Basketball, Billiards, Birding, Boating, Bowling, Boxing and MMA, Camps, Climbing, Coaching, Collecting, Crafts, Cricket, Cycling, Disabled, Events, Extreme Sports, Fantasy, Fishing, Football, Geocaching, Golf, Hang Gliding, Hockey, Horseracing, Kites, Knives, Lacrosse, Martial Arts, Models, Motorsports, Organizations, Outdoors, Paintball, Parties, People, Rugby, Running, Scouting, Scuba Diving, Skateboarding, Skating, Soccer, Surfing, Swimming, Table Tennis, Team Spirit, Tennis, Theme Parks, Track and Field, Volleyball, Weight Lifting, Winter Sports, Wrestling
Travel (41,287)
Aircraft Charter, Cruises, Hotels and Accomodation, 7 More...
Aircraft Charter, Cruises, Hotels and Accomodation, Limousines, Luggage, Taxis and Chauffeurs, Tours, Travel Agents, Vacation Packages, Vehicle Rental
Currently TrendingMore...
Recent Searches
Newest Featured
Add a site
Healthcare Marketing Agency in London - Healthcare Marketing Agency in London. Helping medical clinics in SEO, PPC, Social Media and more.
Healthcare Marketing Agency in London
Healthcare Marketing Agency in London. Helping medical clinics in SEO, PPC, Social Media and more.
https://smtdigital.co.uk Marketing and Advertising - More Details
Total Locker Service - Free UK delivery on all our storage solutions, massive range of locker locks and parts. School storage and metal storage solutions are available on a 5-day delivery.
Total Locker Service
Free UK delivery on all our storage solutions, massive range of locker locks and parts. School storage and metal storage solutions are available on a 5-day delivery.
https://total-locker-service.com/ Shopping, Office Products - More Details
MATERNITY AND NEWBORN PHOTOGRAPHY - Professional maternity, newborn, cake smash and family photography in Toronto
MATERNITY AND NEWBORN PHOTOGRAPHY
Professional maternity, newborn, cake smash and family photography in Toronto
https://maternityandnewborn.com/ Arts and Entertainment, Photography, Photographers - More Details
Window & Door Supplier - Colin's Sash Windows is best known for disrupting the upvc sash window market in the UK in 2014 by introducing affordable fixed prices for upvc sash windows in the UK. Before this they were generally only available at very high prices through window installers. Today they are market leaders in cheaper alternatives to the renowned steel Crittall interior and exterior windows and doors.
Window & Door Supplier
Colin's Sash Windows is best known for disrupting the upvc sash window market in the UK in 2014 by introducing affordable fixed prices for upvc sash windows in the UK. Before this they were generally only available at very high prices through window installers. Today they are market leaders in cheaper alternatives to the renowned steel Crittall interior and exterior windows...
https://colinssashwindows.co.uk/ Home, Windows and Siding - More Details
agencecybele.fr - Cybèle Agency in Mérignac, near Bordeaux. Specializing in custom website creation, WordPress CMS, and SEO.
agencecybele.fr
Cybèle Agency in Mérignac, near Bordeaux. Specializing in custom website creation, WordPress CMS, and SEO.
https://agencecybele.fr/ Computers and Internet, Web Design and Development - More Details
Recent social activity
View more
heisener joined the team as a Viesearch editor!
Being a trusted online electronic parts/components supplier, Heisener partners with original manufacturers. Enjoy affordable prices for quality products.
Tuesday, June 25th, 2024 at 10:32pm
Queensland Probate submitted a new listing
Tuesday, June 25th, 2024 at 10:23pm
Buildmy Place activated a new listing for RTA - Grey Shaker - Base Microwave Cabinet |...
Tuesday, June 25th, 2024 at 10:14pm
Flora Beal activated a new listing for Greenhouse Kits
Tuesday, June 25th, 2024 at 10:03pm
dbmci activated a new listing for DBMCI: India's Biggest NEET PG Preparation Path
Tuesday, June 25th, 2024 at 10:02pm
Recently Viewed Listings
SD Bookkeeping & Taxes dba SD Taxes & Accounting - Personal and Business Accounting, Bookkeeping, and Tax Preparation servicesContact Us | 972-512-0980 | Garage Door Repair Murphy, TX - Quality is one of the most important things for us here at Garage Door Repair Murphy.INTERIOR DESIGNERS IN KANNUR - DLIFE Home Interiors has been setting the standard for Interior Design company in Kannur since it's establishment 19 years ago. They have earned a reputation as one of the top companies in their field, having successfully completed over 9000 projects and counting!Videocon repair center in Kathmandu, Lalitpur and Bhaktapur-Smartcare - Introducing SmartCare, your trusted Videocon LED/LCD TV Repair Center serving Kathmandu, Lalitpur, and Bhaktapur. With our team's expertise, we specialize in servicing Videocon LED/LCD TVs, ensuring optimal picture quality and longevity. Enjoy peace of mind with our 1-year warranty on repairs and our commitment to customer satisfaction. For swift assistance in Kathmandu, Lalitpur, or Bhaktapur, contact us at 9851201580, 9802074555, or 015970066. Inquiries are welcome via...Santa Paula Garage Doors Repair - Santa Paula Garage Doors Repair - Welcome! Is the garage door stuck up or down and you are captured? Do not try to repair this all by yourself because it can make matters a whole lot worse. We will repair your garage door. Call now. Our workers are quick, polite together with knowledgeable.
David Muller Photography - David Muller is a Wedding photographer and offers professional, creative and affordable photography packages in the Cape Winelands area, including Paarl, Franschhoek and surroundings. He also offers couple, family and event photography.ELP Arbuthnott McClanachan - Employment Law - ELP Arbuthnott McClanachan's Employment Law Practice is a specialist team of employment lawyers based in Edinburgh. We offer expert legal advice on all matters related to employment law for both employees and employers.eastern medical college bangladesh - Bangladesh is a best education hub for foreign students now a days. This country provides one of the economical and quality education system for students in various fields like engineering, medical, management etc. If we talk about best medical college in Bangladesh for doing MBBS degree then there are so many medical college of Bangladesh come in this list. But Eastern Medical College Bangladesh is a best destination for Indian students in current time.Garage Door Repair in Oviedo, FL 24/7 - Residential * Commercial - 24/7 Garage Door Repair, Installation & Maintenance Services in Oviedo, FL - Residential * Commercial - Call (407) 708-9557Legal Translations - A la Carte Translations always employs sworn and court-certified translators who are native speakers and whose skill and experience reflect in each translator's final product.
Recently Active Editors
delsplailltoolsshreesteelindiaeasyquizzzmildredhoitus
quadbikedubaiexcellency123swastispinemindravindersingalstylondecor
Random Editor

Amara Hall
Top Featured
Add a site
Antisan Yacht - Antisan is 33m motor yacht based in Cannes in the south of France. The yacht is available to charter by the day, week or longer. Antisan sleeps up to 11 guests in 5 cabins. The yacht has a fabulous crew, including an amazing Chef. Unlike other charter yachts, Antisan is not limited to 12 guests when cruising. She is legally allowed to cruise in daylight hours with up to 40 people onboard. This makes Antisan the ideal yacht for day charters for large groups, as well as weddings and...
Antisan Yacht
Antisan is 33m motor yacht based in Cannes in the south of France. The yacht is available to charter by the day, week or longer. Antisan sleeps up to 11 guests in 5 cabins. The yacht has a fabulous crew, including an amazing Chef. Unlike other charter yachts, Antisan is not limited to 12 guests when cruising. She is legally allowed to cruise in daylight hours with up to...
https://bespokeyachtcharter.com/antisan/
Expires on Monday, February 8th, 2044 Sports and Recreation, Boating - More Details
Madison Liquidators - Looking for office furniture for your business or home? Check out Madison Liquidators for an extensive collection of office chairs, desks, conference tables, file cabinets, and much more. Enjoy the convenience of direct shipping to your doorstep.
Madison Liquidators
Looking for office furniture for your business or home? Check out Madison Liquidators for an extensive collection of office chairs, desks, conference tables, file cabinets, and much more. Enjoy the convenience of direct shipping to your doorstep.
https://madisonliquidators.com/
Expires on Tuesday, July 22nd, 2042 Home, Furniture - More Details
MMA Podcast | Coupons - Welcome to our MMA podcast based in Chicago, where we explore the fine line between serious and ridiculous. Join us as we delve into the world of mixed martial arts and share our unique insights and perspectives.
MMA Podcast | Coupons
Welcome to our MMA podcast based in Chicago, where we explore the fine line between serious and ridiculous. Join us as we delve into the world of mixed martial arts and share our unique insights and perspectives.
http://mmanuts.com/
Expires on Saturday, July 27th, 2041 Sports and Recreation, Boxing and MMA - More Details
Comfyhome Heating & Cooling Melbourne - Comfyhome Specialised in gas ducted heating, evaporative cooling, split system and air conditioning installation, service and repairs. ComfyHome adheres to a customer-centric approach in a bid to provide premium heating and cooling solutions that fulfill your needs and align with your budget. We bring you convenience, affordability, and quality of service you won't find anywhere else.
Comfyhome Heating & Cooling Melbourne
Comfyhome Specialised in gas ducted heating, evaporative cooling, split system and air conditioning installation, service and repairs. ComfyHome adheres to a customer-centric approach in a bid to provide premium heating and cooling solutions that fulfill your needs and align with your budget. We bring you convenience, affordability, and quality of service you won't find...
https://www.comfyhome.com.au
Expires on Friday, July 12th, 2041 Home, Heating and Cooling - More Details
Office Furniture - Madison Liquidators is a nationwide distributor of new performance laminate, veneer and solid wood office furniture. Visit us for great deals at liquidation prices!
Office Furniture
Madison Liquidators is a nationwide distributor of new performance laminate, veneer and solid wood office furniture. Visit us for great deals at liquidation prices!
https://www.madisonliquidators.com/office-furniture/
Expires on Wednesday, May 15th, 2041 Home, Furniture - More Details
© 2004-2024 Viesearch. 16 Hudson Ave #3201, Glens Falls, NY 12801   Auctions   Terms   Privacy   RSS