Viesearch
Join Now  Sign In  
Viesearch - Human Powered Search Engine
598,166,191 Searches  3,399,654 Submissions  862,486 Sites  4,942 Featured  1,083 Categories  331,589 Editors
Arts and Entertainment (79,131)
Animation, Architecture, Art History, 29 More...
Animation, Architecture, Art History, Astrology and Horoscopes, Body Modification, Classical Studies, Comics, Crafts, Dance, Design, Entertainment, Fashion, Graphic Design, Humanities, Humor, Illustration, Literature, Movies, Music, Myths and Folktales, Native and Tribal, Online Writing, Performing Arts, Photography, Radio, Rhetoric, Television, Theatre, Typography, Video, Visual Arts, Writers Resources
Business (97,859)
Agriculture, Bookkeeping and Accounting, Construction, 31 More...
Agriculture, Bookkeeping and Accounting, Construction, Consulting, Cooperatives, Customer Service, Engineering, Event Planning, Freight Brokerage and Transportation, Human Resources, Industrial, Information Services, International Business and Trade, Life Coaching, Locksmiths, Major Companies, Management, Manufacturing, Messengers and Couriers, Mining, Opportunities, Outsourcing, Painting Services, Personal and Virtual Assistants, Point of Sale Hardware and Systems, Private Investigation, Publishing and Printing, Security Services, Small Business, Telecommunications, Transcription Services, Translation Services, Waste Management and Recycling, Work At Home
Computers and Internet (88,481)
Algorithms, Artificial Intelligence, Chats and Forums, 29 More...
Algorithms, Artificial Intelligence, Chats and Forums, Computer Repair, Computer Science, Cyberculture, Data Backup, Data Recovery, Desktop and Mobile Wallpapers, Desktop Publishing, Domain Names, E-Commerce, Freelancers, Hardware, Internet, Mobile Computing, Open Source, Operating Systems, Podcasts, Portal, Programming, Robotics, Search Engines, Security, Social Networking, Software, Systems, Technical Guides and Support, Virtual Reality, Web Design and Development, Web Hosting, Webmaster Resources
Games (7,372)
Board Games, Card Games, Coin-Op, 17 More...
Board Games, Card Games, Coin-Op, Computer Games, Dice, Flash Game Arcades, Hand Games, Hand-Eye Coordination, Miniatures, Mobile Games, Online, Paper and Pencil, Party Games, Play-By-Mail, Puzzles, Roleplaying, Tile Games, Trading Card Games, Video Games, Yard, Deck, and Table Games
Health and Fitness (72,691)
Aging, Allergies, Alternative, 45 More...
Aging, Allergies, Alternative, Anaesthesiology, Animal, Ayurveda, Beauty, Cardiology, Child Health, Chiropractic, Clinical Research, Conditions and Diseases, Cosmetic Surgery, Dental, Dermatology, Diagnostic Imaging, Disabilities, DNA Testing, First Aid, Fitness, Healthcare Industry, Hearing and Audiology, Home Health Care, Homeopathy, Hygiene, Massage Therapy, Medical Billing, Medical Equipment, Medical ID Bracelets, Medicine, Mental Health, Nephrology, Neurology, Nursing, Nutrition, Obstetrics and Gynecology, Oncology, Ophthalmology and Optometry, Orthopedics, Otorhinolaryngology, Pain Management, Physical Therapy, Physiotherapy, Podiatry, Rheumatology, Senior Care, Urology, Weight Loss
Home (110,947)
Apartment Living, Appliance Repair, Asbestos Removal, 42 More...
Apartment Living, Appliance Repair, Asbestos Removal, Bathroom, Carpeting and Flooring, Chimney Cleaning, Cleaning Services, Cooking, Do-It-Yourself, Domestic Services, Electricians, Emergency Preparation, Entertaining, Family, Fences, Furniture, Garage, Heating and Cooling, Home and Office Safety, Home Automation, Home Business, Home Improvement, Home Restoration and Repair, Homemaking, Homeowners, Interior Design, Kitchen, Laundry and Dry Cleaning, Lighting, Packers and Movers, Personal Finance, Personal Organization, Pest Control, Pets, Plumbing, Roofs and Gutters, Rural Living, Security, Seniors, Storage, Swimming Pools and Spas, Tree Cutting and Removal, Urban Living, Windows and Siding, Yard and Garden
Jobs and Employment (6,098)
Accountancy, Administration, Airport, 21 More...
Accountancy, Administration, Airport, Background Screening, Banking, Call Center, Civil Service, Construction, Customer Service, Driving, Fashion Design, Finance, Hospitality, Marketing, Office, Online Jobs, Part Time, Recruitment Agencies, Resume Writing, Retail, Sales, Teaching, Teaching Assistant, Warehouse
Kids and Teens (7,247)
Arts, Babies, Childcare, 6 More...
Arts, Babies, Childcare, People and Society, Pre-School, School Time, Sports and Hobbies, Teen Life, Your Family
Marketing and Advertising (32,792)
Agencies, Banner Exchange, Directories, 12 More...
Agencies, Banner Exchange, Directories, Forum Posting Services, Link Building, Magazine, Newspaper, Outdoor, Pay Per Click, Promotional Products, Search Engine Optimization, Signage, Television, Trade Show Displays, Traffic Exchange
News (19,698)
Current Events, Internet Broadcasts, Journals, 4 More...
Current Events, Internet Broadcasts, Journals, Magazines and E-zines, Newspapers, Television, Weather
Real Estate (29,209)
Apartment Rentals, Appraisers and Consultants, Brokerages, 10 More...
Apartment Rentals, Appraisers and Consultants, Brokerages, Commercial, Coworking and Office Space, Farm Land, For Sale By Owner, Home Inspection, Plots and Land For Sale, Property Management, Realtors, Residential Projects, Timeshare
Reference and Education (77,934)
Advice, Almanacs, Articles, 17 More...
Advice, Almanacs, Articles, Bibliography, Biography, Blogs, College and University, Education and Training, Educational Resources, Encyclopedias, Genealogy, History, Knowledge Management, Libraries, Living History, Maps, Museums, Resources, Thesauri, World Records
Regional (21,494)
Africa, Argentina, Armenia, 39 More...
Africa, Argentina, Armenia, Asia, Australia, Austria, Brazil, Canada, Caribbean, Central America, Croatia, Czech Republic, Denmark, Europe, Finland, Germany, Greece, Hong Kong, India, Indonesia, Ireland, Israel, Italy, Japan, Lithuania, Middle East, Netherlands, New Zealand, North America, Norway, Oceania, Philippines, Polar Regions, Puerto Rico, Russia, Slovakia, South America, Sweden, Taiwan, United Kingdom, United States, Zimbabwe
Science (9,043)
Aerospace and Aeronautics, Astronomy, Biology, 19 More...
Aerospace and Aeronautics, Astronomy, Biology, Chemistry, Conferences, Earth Sciences, Environment and Nature, Geology and Geophysics, Institutions, Instruments and Supplies, Mathematics, Methods and Techniques, Museums, Nanotechnology, News and Media, Physics, Publications, Reference, Renewable Energy, Science in Society, Technology, Wildlife
Shopping (105,630)
Antiques, Appliances, Art Supplies, 22 More...
Antiques, Appliances, Art Supplies, Auctions, Autos, Beauty Products, Books, Classifieds, Clothing and Shoes, Coupons and Deals, Electronics, Flowers, Food and Beverage, Gifts, Glassware, Greeting Cards, Jewelry, Mobile Phones, Motorcycles, Office Products, Sporting Goods, Tickets, Tools and Hardware, Toys, Wholesale
Society (30,590)
Activism, Crime, Death, 26 More...
Activism, Crime, Death, Disabled, Economics, Ethnicity, Folklore, Future, Holidays, Issues, Language and Linguistics, Law, Lifestyle Choices, Men, Military, Organizations, Paranormal, People, Philanthropy, Philosophy, Roads and Highways, Social Sciences, Sociology, Subcultures, Support Groups, Trains and Railroads, Urban Legends, Weddings, Women
Sports and Recreation (24,735)
Archery, Audio and Radio, Aviation, 55 More...
Archery, Audio and Radio, Aviation, Badminton, Baseball, Basketball, Billiards, Birding, Boating, Bowling, Boxing and MMA, Camps, Climbing, Coaching, Collecting, Crafts, Cricket, Cycling, Disabled, Events, Extreme Sports, Fantasy, Fishing, Football, Geocaching, Golf, Hang Gliding, Hockey, Horseracing, Kites, Knives, Lacrosse, Martial Arts, Models, Motorsports, Organizations, Outdoors, Paintball, Parties, People, Rugby, Running, Scouting, Scuba Diving, Skateboarding, Skating, Soccer, Surfing, Swimming, Table Tennis, Team Spirit, Tennis, Theme Parks, Track and Field, Volleyball, Weight Lifting, Winter Sports, Wrestling
Travel (41,535)
Aircraft Charter, Cruises, Hotels and Accomodation, 7 More...
Aircraft Charter, Cruises, Hotels and Accomodation, Limousines, Luggage, Taxis and Chauffeurs, Tours, Travel Agents, Vacation Packages, Vehicle Rental
Currently TrendingMore...
Recent Searches
Newest Featured
Add a site
AI Jobster - AiJobster is a premier platform dedicated to job search in AI companies and remote AI jobs. It offers comprehensive listings spanning AI jobs, artificial intelligence roles, machine learning opportunities, data science positions, and tech careers. AiJobster connects job seekers with top AI-driven organizations globally.
AI Jobster
AiJobster is a premier platform dedicated to job search in AI companies and remote AI jobs. It offers comprehensive listings spanning AI jobs, artificial intelligence roles, machine learning opportunities, data science positions, and tech careers. AiJobster connects job seekers with top AI-driven organizations globally.
https://aijobster.work/ Jobs and Employment - More Details
Talantr.com: Trending Jobs Opportunities in USA - Explore diverse job opportunities at Talantr.com! Find full-time and part-time positions with top companies like Uber, DoorDash, Amazon Warehouse, CarMax, Sodexo, Refresco, Honor, Ecolab, and Veyo across the USA. Whether you’re seeking a career change or your first job, Talantr connects you with roles that match your skills and aspirations. Don’t miss out on these exciting opportunities—apply now to take the next step in your professional journey with Talantr!
Talantr.com: Trending Jobs Opportunities in USA
Explore diverse job opportunities at Talantr.com! Find full-time and part-time positions with top companies like Uber, DoorDash, Amazon Warehouse, CarMax, Sodexo, Refresco, Honor, Ecolab, and Veyo across the USA. Whether you’re seeking a career change or your first job, Talantr connects you with roles that match your skills and aspirations. Don’t miss out on these...
https://talantr.com/ Jobs and Employment - More Details
eFLoristApp - The easiest way to make someone happy? Send and deliver flowers! It is now even easier, you can do it right from your Mobile Device! Several bouquets ready to be delivered in more than 120 countries worldwide!
eFLoristApp
The easiest way to make someone happy? Send and deliver flowers! It is now even easier, you can do it right from your Mobile Device! Several bouquets ready to be delivered in more than 120 countries worldwide!
https://www.efloristapp.com/ Computers and Internet, E-Commerce - More Details
NGI Drain Cleaning & Hydro Jetting - NGI Drain Cleaning & Hydro Jetting provides a comprehensive suite of drain cleaning services in Atlanta. From hydro jetting and trenchless solutions to water line repair and storm drain cleaning, we've got you covered. Our professional drain cleaning services are more effective than traditional methods and are designed to tackle persistent blockages in hard-to-reach areas of your plumbing system, including your kitchen sink drains.
NGI Drain Cleaning & Hydro Jetting
NGI Drain Cleaning & Hydro Jetting provides a comprehensive suite of drain cleaning services in Atlanta. From hydro jetting and trenchless solutions to water line repair and storm drain cleaning, we've got you covered. Our professional drain cleaning services are more effective than traditional methods and are designed to tackle persistent blockages in hard-to-reach areas...
https://ngidrainhydrojetting.com/ Home, Plumbing - More Details
Great Lakes Direct - An information guide to the Great Lakes region spanning the border between the USA and Canada.
Great Lakes Direct
An information guide to the Great Lakes region spanning the border between the USA and Canada.
https://www.greatlakesdirect.com/ Travel - More Details
Recent social activity
View more
JosephUSA submitted a new listing
Saturday, July 6th, 2024 at 12:37am
Stylon Decor submitted a new listing and activated a new listing for Customized Roller Blind With Pelmet Blackout...
Saturday, July 6th, 2024 at 12:36am
JosephUSA submitted a new listing and activated a new listing for Safety Rules for Swimmers
Saturday, July 6th, 2024 at 12:32am
makeupshop joined the team as a Viesearch editor!
MakeupShop.ro este destinația ta online pentru produse de îngrijire a tenului de cea mai înaltă calitate. Descoperă o gamă variată de seruri cu retinol și creme cu retinol, ideale pentru a obține unui ten sănătos și radiant și pentru a scăpa de riduri.
Saturday, July 6th, 2024 at 12:28am
Exotic Metal submitted a new listing, tagged, and activated a new listing for Inconel 601 Pipes & Tubes Suppliers In India
uns no 4400stockists of alloy 20stockists of special metalsstockists of corrosion metalsexporter of nickel alloysimporter of nickel alloysstockists of nickel alloy round barsalloy platesimporter of nickelnickel alloy round bars
Saturday, July 6th, 2024 at 12:27am
Recently Viewed Listings
Study in UK - The United Kingdom(UK) is popular for its exemplary education system and the legacy of welcoming international students into its reputed universities. According to statistics, the UK is counted among the most coveted countries for international students due to its remarkable research alternatives, diverse population, and amazing jobs. Apart from these, many other factors are responsible for influencing students to study in UK such as shorter duration of courses, financial aid, lower...Packers and Movers in Delhi - Safe Packers Movers Delhi is a Delhi based top packers and movers company and provide all types relocation services as per client's packers & movers requirements. Our Relocation services are local packing and moving, relocation of exhibition and trade fairs, car transportation, ware housing and office shifting etc.Bond cleaning Brisbane | Bond cleaning Brisbane Northside - Bond cleaning services brisbane, Cheap bond cleaning brisbane, Exit Cleaning Brisbane, End of lease Cleaning Brisbane, Bond back Cleaning Brisbane.Ratio Energy - Ratio Energy provides optimization and A.I. for energy storage plants. Our flagship product RatioEMS and RatioSIM provides end-to-end energy storage. management.Spans On Hire | Spans Material Rental in Vadodara| Hitech Scaffolding Pvt. Ltd. - Hi-Tech Scaffolding Pvt. Ltd., work with a single-minded focus of supplying high quality scaffolding equipment's in the desired quantity to our clients on schedule. Props, Spans, Centering Plates, H-Frames, Pipes, Couplers, U head, Concrete Pumps, among others. Apart from offering scaffolding material on lease in supplies.spans material rental in Vadodara,spans on hire in Vadodara
Criminal Trial Attorney | Rubas Law Offices - Rubas Law Offices represents individuals in complex matters involving criminal defense, DWI/municipal court, and commercial cases.Lower dolpo trekking - Explore Dolpo Trek and Expedition, specialized in upper and lower dolpo trekking is the most dedicated trekking company of Nepal.How CNC Turned Components Boost Productivity? - Computer Numerical Control, popularly known as CNC, turned components have been ranked as the top segment of the industrial manufacturing process. Every company using CNC to produce its components or parts has gained enormous profits and increased productivity. These precision-engineered elements manufactured using CNC offer high accuracy, less downtime, and more speed. Here’s all you need to know about CNC-turned components:Buy Mobile Genset from Kala Biz - Designing and manufacturing a Mobile Genset that can handle our clients power generation needs is the most crucial aspect of our organization.PSD to Wordpress - Get cheap and best PSD to HTML5 Responsive website conversion. Professionally hand coded markup for your PSD design file to wordpress by htmltowordpress.
Recently Active Editors
everflexfitnessshasanpipingvamikaiamtrajeshjosephremovetiktok
advance_valveseventplanner027longdrivecarsupstreamdubairippest
Random Editor

elianadavis
Top Featured
Add a site
Antisan Yacht - Antisan is 33m motor yacht based in Cannes in the south of France. The yacht is available to charter by the day, week or longer. Antisan sleeps up to 11 guests in 5 cabins. The yacht has a fabulous crew, including an amazing Chef. Unlike other charter yachts, Antisan is not limited to 12 guests when cruising. She is legally allowed to cruise in daylight hours with up to 40 people onboard. This makes Antisan the ideal yacht for day charters for large groups, as well as weddings and...
Antisan Yacht
Antisan is 33m motor yacht based in Cannes in the south of France. The yacht is available to charter by the day, week or longer. Antisan sleeps up to 11 guests in 5 cabins. The yacht has a fabulous crew, including an amazing Chef. Unlike other charter yachts, Antisan is not limited to 12 guests when cruising. She is legally allowed to cruise in daylight hours with up to...
https://bespokeyachtcharter.com/antisan/
Expires on Monday, February 8th, 2044 Sports and Recreation, Boating - More Details
Madison Liquidators - Looking for office furniture for your business or home? Check out Madison Liquidators for an extensive collection of office chairs, desks, conference tables, file cabinets, and much more. Enjoy the convenience of direct shipping to your doorstep.
Madison Liquidators
Looking for office furniture for your business or home? Check out Madison Liquidators for an extensive collection of office chairs, desks, conference tables, file cabinets, and much more. Enjoy the convenience of direct shipping to your doorstep.
https://madisonliquidators.com/
Expires on Tuesday, July 22nd, 2042 Home, Furniture - More Details
MMA Podcast | Coupons - Welcome to our MMA podcast based in Chicago, where we explore the fine line between serious and ridiculous. Join us as we delve into the world of mixed martial arts and share our unique insights and perspectives.
MMA Podcast | Coupons
Welcome to our MMA podcast based in Chicago, where we explore the fine line between serious and ridiculous. Join us as we delve into the world of mixed martial arts and share our unique insights and perspectives.
http://mmanuts.com/
Expires on Saturday, July 27th, 2041 Sports and Recreation, Boxing and MMA - More Details
Comfyhome Heating & Cooling Melbourne - Comfyhome Specialised in gas ducted heating, evaporative cooling, split system and air conditioning installation, service and repairs. ComfyHome adheres to a customer-centric approach in a bid to provide premium heating and cooling solutions that fulfill your needs and align with your budget. We bring you convenience, affordability, and quality of service you won't find anywhere else.
Comfyhome Heating & Cooling Melbourne
Comfyhome Specialised in gas ducted heating, evaporative cooling, split system and air conditioning installation, service and repairs. ComfyHome adheres to a customer-centric approach in a bid to provide premium heating and cooling solutions that fulfill your needs and align with your budget. We bring you convenience, affordability, and quality of service you won't find...
https://www.comfyhome.com.au
Expires on Friday, July 12th, 2041 Home, Heating and Cooling - More Details
Office Furniture - Madison Liquidators is a nationwide distributor of new performance laminate, veneer and solid wood office furniture. Visit us for great deals at liquidation prices!
Office Furniture
Madison Liquidators is a nationwide distributor of new performance laminate, veneer and solid wood office furniture. Visit us for great deals at liquidation prices!
https://www.madisonliquidators.com/office-furniture/
Expires on Wednesday, May 15th, 2041 Home, Furniture - More Details
© 2004-2024 Viesearch. 16 Hudson Ave #3201, Glens Falls, NY 12801   Auctions   Terms   Privacy   RSS