Viesearch
Viesearch - Human Powered Search Engine
595,521,945 Searches  3,392,251 Submissions  860,634 Sites  4,928 Featured  1,083 Categories  329,185 Editors
Newest Featured
Online shop with low cost products and free fast shipping
Goldleaf Law is a law firm of wrongful death personal injury, and civil litigation lawyers. At Goldleaf, you are a member of our team. You are seen, you are heard, you are considered, every step of the way. Our attorneys put their heads and hearts together on every case, to come up with the best approach and results for our clients.
Need Christian translation? Christian Lingua has translated over 35 million words into 139 languages for 2000+ Christian clients since 2006. Our clients include CBN, Rick Warren, Gateway Church, OneHope, HeartCry, and many others. Start your Christian translation project today with the Christian company you can trust!
Your trusted partner for top-tier Appliance Repair and Installation Services spanning the entire Canadian landscape. With a dedicated team of skilled technicians, we specialize in diagnosing and resolving a wide range of appliance issues, ensuring seamless installations for new equipment.
Lightflows is a mobile app development company, an agency you can trust with your project. We provide several app development services, including native and hybrid app development, including React Native and Ionic. With an experienced in-house app design team, you can have confidence that we can deliver complex app projects quickly and efficiently. We can help you navigate...
Recent social activity
Ahmad Ali activated a new listing for Corporate Bus Hire Sharjah
Monday, June 17th, 2024 at 2:17pm
H Raja Photography joined the team as a Viesearch editor!
Best Photographer In Dubai
Monday, June 17th, 2024 at 2:06pm
Wiculty learning solutions submitted a new listing and activated a new listing for Beyond the Badge: The True Impact of DevOps...
Monday, June 17th, 2024 at 1:46pm
Ahmad Ali submitted a new listing and activated a new listing for OLD DUBAI TOUR
Monday, June 17th, 2024 at 1:09pm
Recently Viewed Listings
cash for Honda cars and Honda car removal - Cash For Honda Cars, as one of the most dependable and trustworthy Honda Wreckers, allows their customers to sell their sc, old, and scrap cars for an impressive amount of up to $9,999 at various locations throughout Brisbane, including the Gold Coast, Sunshine Coast, Toowoomba, and Ipswich.Airline Booking API - Airline Booking APIs are a set of web services to access flight deals from different flight suppliers and consolidators. This airline API enables travel agencies, travel companies, and tour operators with access to global flight deals and content such as roundtrip, one-way, multi-city, and group booking combinations.Latest technology tools for cutting diamonds - spproduct - home - Buy our Advanced technology cutting tools with precise result, various types of tools available for diamond cutting, reliable and flexible for use. Wide range of products like resin bond, vitrified bruting tool. All types of tool in different sizes.Glass Repair Birmingham | Kitts Green Glass - Elevate your space with expert double glazing services by the premier glazier in Birmingham. Enhance energy efficiency and aesthetics with our top-notch window solutions. Trust us for quality craftsmanship and unmatched professionalism in every project.Domain Registration - Domain Registration bhubaneswar:   Register Web Domain Provides Cheap Domain registration India,  which helps you to register domain name fast,  simple,  and affordable. Our Domain search allows you to search   all country domains with easy steps.
Celica Jeep - Unveiling the New Jeep Car - Experience the perfect blend of elegance and ruggedness in the latest Jeep Model. Conquer both city streets and untamed trails with its powerful performance and refined interior.Mark's Medical Mobility, LLC - At Mark's Medical Mobility, LLC in Boca Raton, we provide exceptional service on power wheelchairs, mobility scooters, lift chairs, hospital beds, and certain medical equipment. We are a mobile service provider (We come to you). We serve Palm Beach, Broward, Dade, Martin, and Saint Lucie Counties. We save our customers a minimum of 36% on service calls compared to the leading national service providers.RepairSmith - Los Angeles, CA•
(877) 907-6484Medical Billing Services in Texas US - Maxremind - Maxremind Inc top rank medical billing company in Texas. We offer medical billing services in all states of USA. Maxremind Inc also offers medical billing services for all specialities.
A Better You - A Better You is a health and aesthetics business in Wellington that focuses on core and pelvic floor health and well-being.
Recently Active Editors
webmaxyofficialadelpharmasavitayadavdemandaygrouprealsteel
kbkbusinessgeminidesignmeetanshitraderedsthecrackexam
Random Editor
Top Featured
Antisan is 33m motor yacht based in Cannes in the south of France. The yacht is available to charter by the day, week or longer. Antisan sleeps up to 11 guests in 5 cabins. The yacht has a fabulous crew, including an amazing Chef. Unlike other charter yachts, Antisan is not limited to 12 guests when cruising. She is legally allowed to cruise in daylight hours with up to...
Looking for office furniture for your business or home? Check out Madison Liquidators for an extensive collection of office chairs, desks, conference tables, file cabinets, and much more. Enjoy the convenience of direct shipping to your doorstep.
Expires on Tuesday, July 22nd, 2042 Home, Furniture - More Details
Welcome to our MMA podcast based in Chicago, where we explore the fine line between serious and ridiculous. Join us as we delve into the world of mixed martial arts and share our unique insights and perspectives.
Expires on Saturday, July 27th, 2041 Sports and Recreation, Boxing and MMA - More Details
Comfyhome Specialised in gas ducted heating, evaporative cooling, split system and air conditioning installation, service and repairs. ComfyHome adheres to a customer-centric approach in a bid to provide premium heating and cooling solutions that fulfill your needs and align with your budget. We bring you convenience, affordability, and quality of service you won't find...
Expires on Friday, July 12th, 2041 Home, Heating and Cooling - More Details
Madison Liquidators is a nationwide distributor of new performance laminate, veneer and solid wood office furniture. Visit us for great deals at liquidation prices!