Viesearch
Join Now  Sign In  
Viesearch - Human Powered Search Engine
591,784,362 Searches  3,385,325 Submissions  860,289 Sites  4,904 Featured  1,083 Categories  326,745 Editors
Arts and Entertainment (79,310)
Animation, Architecture, Art History, 29 More...
Animation, Architecture, Art History, Astrology and Horoscopes, Body Modification, Classical Studies, Comics, Crafts, Dance, Design, Entertainment, Fashion, Graphic Design, Humanities, Humor, Illustration, Literature, Movies, Music, Myths and Folktales, Native and Tribal, Online Writing, Performing Arts, Photography, Radio, Rhetoric, Television, Theatre, Typography, Video, Visual Arts, Writers Resources
Business (97,316)
Agriculture, Bookkeeping and Accounting, Construction, 31 More...
Agriculture, Bookkeeping and Accounting, Construction, Consulting, Cooperatives, Customer Service, Engineering, Event Planning, Freight Brokerage and Transportation, Human Resources, Industrial, Information Services, International Business and Trade, Life Coaching, Locksmiths, Major Companies, Management, Manufacturing, Messengers and Couriers, Mining, Opportunities, Outsourcing, Painting Services, Personal and Virtual Assistants, Point of Sale Hardware and Systems, Private Investigation, Publishing and Printing, Security Services, Small Business, Telecommunications, Transcription Services, Translation Services, Waste Management and Recycling, Work At Home
Computers and Internet (88,298)
Algorithms, Artificial Intelligence, Chats and Forums, 29 More...
Algorithms, Artificial Intelligence, Chats and Forums, Computer Repair, Computer Science, Cyberculture, Data Backup, Data Recovery, Desktop and Mobile Wallpapers, Desktop Publishing, Domain Names, E-Commerce, Freelancers, Hardware, Internet, Mobile Computing, Open Source, Operating Systems, Podcasts, Portal, Programming, Robotics, Search Engines, Security, Social Networking, Software, Systems, Technical Guides and Support, Virtual Reality, Web Design and Development, Web Hosting, Webmaster Resources
Games (7,462)
Board Games, Card Games, Coin-Op, 17 More...
Board Games, Card Games, Coin-Op, Computer Games, Dice, Flash Game Arcades, Hand Games, Hand-Eye Coordination, Miniatures, Mobile Games, Online, Paper and Pencil, Party Games, Play-By-Mail, Puzzles, Roleplaying, Tile Games, Trading Card Games, Video Games, Yard, Deck, and Table Games
Health and Fitness (72,379)
Aging, Allergies, Alternative, 45 More...
Aging, Allergies, Alternative, Anaesthesiology, Animal, Ayurveda, Beauty, Cardiology, Child Health, Chiropractic, Clinical Research, Conditions and Diseases, Cosmetic Surgery, Dental, Dermatology, Diagnostic Imaging, Disabilities, DNA Testing, First Aid, Fitness, Healthcare Industry, Hearing and Audiology, Home Health Care, Homeopathy, Hygiene, Massage Therapy, Medical Billing, Medical Equipment, Medical ID Bracelets, Medicine, Mental Health, Nephrology, Neurology, Nursing, Nutrition, Obstetrics and Gynecology, Oncology, Ophthalmology and Optometry, Orthopedics, Otorhinolaryngology, Pain Management, Physical Therapy, Physiotherapy, Podiatry, Rheumatology, Senior Care, Urology, Weight Loss
Home (110,409)
Apartment Living, Appliance Repair, Asbestos Removal, 42 More...
Apartment Living, Appliance Repair, Asbestos Removal, Bathroom, Carpeting and Flooring, Chimney Cleaning, Cleaning Services, Cooking, Do-It-Yourself, Domestic Services, Electricians, Emergency Preparation, Entertaining, Family, Fences, Furniture, Garage, Heating and Cooling, Home and Office Safety, Home Automation, Home Business, Home Improvement, Home Restoration and Repair, Homemaking, Homeowners, Interior Design, Kitchen, Laundry and Dry Cleaning, Lighting, Packers and Movers, Personal Finance, Personal Organization, Pest Control, Pets, Plumbing, Roofs and Gutters, Rural Living, Security, Seniors, Storage, Swimming Pools and Spas, Tree Cutting and Removal, Urban Living, Windows and Siding, Yard and Garden
Jobs and Employment (6,061)
Accountancy, Administration, Airport, 21 More...
Accountancy, Administration, Airport, Background Screening, Banking, Call Center, Civil Service, Construction, Customer Service, Driving, Fashion Design, Finance, Hospitality, Marketing, Office, Online Jobs, Part Time, Recruitment Agencies, Resume Writing, Retail, Sales, Teaching, Teaching Assistant, Warehouse
Kids and Teens (7,267)
Arts, Babies, Childcare, 6 More...
Arts, Babies, Childcare, People and Society, Pre-School, School Time, Sports and Hobbies, Teen Life, Your Family
Marketing and Advertising (32,607)
Agencies, Banner Exchange, Directories, 12 More...
Agencies, Banner Exchange, Directories, Forum Posting Services, Link Building, Magazine, Newspaper, Outdoor, Pay Per Click, Promotional Products, Search Engine Optimization, Signage, Television, Trade Show Displays, Traffic Exchange
News (20,101)
Current Events, Internet Broadcasts, Journals, 4 More...
Current Events, Internet Broadcasts, Journals, Magazines and E-zines, Newspapers, Television, Weather
Real Estate (29,391)
Apartment Rentals, Appraisers and Consultants, Brokerages, 10 More...
Apartment Rentals, Appraisers and Consultants, Brokerages, Commercial, Coworking and Office Space, Farm Land, For Sale By Owner, Home Inspection, Plots and Land For Sale, Property Management, Realtors, Residential Projects, Timeshare
Reference and Education (77,174)
Advice, Almanacs, Articles, 17 More...
Advice, Almanacs, Articles, Bibliography, Biography, Blogs, College and University, Education and Training, Educational Resources, Encyclopedias, Genealogy, History, Knowledge Management, Libraries, Living History, Maps, Museums, Resources, Thesauri, World Records
Regional (21,599)
Africa, Argentina, Armenia, 39 More...
Africa, Argentina, Armenia, Asia, Australia, Austria, Brazil, Canada, Caribbean, Central America, Croatia, Czech Republic, Denmark, Europe, Finland, Germany, Greece, Hong Kong, India, Indonesia, Ireland, Israel, Italy, Japan, Lithuania, Middle East, Netherlands, New Zealand, North America, Norway, Oceania, Philippines, Polar Regions, Puerto Rico, Russia, Slovakia, South America, Sweden, Taiwan, United Kingdom, United States, Zimbabwe
Science (9,002)
Aerospace and Aeronautics, Astronomy, Biology, 19 More...
Aerospace and Aeronautics, Astronomy, Biology, Chemistry, Conferences, Earth Sciences, Environment and Nature, Geology and Geophysics, Institutions, Instruments and Supplies, Mathematics, Methods and Techniques, Museums, Nanotechnology, News and Media, Physics, Publications, Reference, Renewable Energy, Science in Society, Technology, Wildlife
Shopping (105,375)
Antiques, Appliances, Art Supplies, 22 More...
Antiques, Appliances, Art Supplies, Auctions, Autos, Beauty Products, Books, Classifieds, Clothing and Shoes, Coupons and Deals, Electronics, Flowers, Food and Beverage, Gifts, Glassware, Greeting Cards, Jewelry, Mobile Phones, Motorcycles, Office Products, Sporting Goods, Tickets, Tools and Hardware, Toys, Wholesale
Society (30,707)
Activism, Crime, Death, 26 More...
Activism, Crime, Death, Disabled, Economics, Ethnicity, Folklore, Future, Holidays, Issues, Language and Linguistics, Law, Lifestyle Choices, Men, Military, Organizations, Paranormal, People, Philanthropy, Philosophy, Roads and Highways, Social Sciences, Sociology, Subcultures, Support Groups, Trains and Railroads, Urban Legends, Weddings, Women
Sports and Recreation (24,778)
Archery, Audio and Radio, Aviation, 55 More...
Archery, Audio and Radio, Aviation, Badminton, Baseball, Basketball, Billiards, Birding, Boating, Bowling, Boxing and MMA, Camps, Climbing, Coaching, Collecting, Crafts, Cricket, Cycling, Disabled, Events, Extreme Sports, Fantasy, Fishing, Football, Geocaching, Golf, Hang Gliding, Hockey, Horseracing, Kites, Knives, Lacrosse, Martial Arts, Models, Motorsports, Organizations, Outdoors, Paintball, Parties, People, Rugby, Running, Scouting, Scuba Diving, Skateboarding, Skating, Soccer, Surfing, Swimming, Table Tennis, Team Spirit, Tennis, Theme Parks, Track and Field, Volleyball, Weight Lifting, Winter Sports, Wrestling
Travel (41,053)
Aircraft Charter, Cruises, Hotels and Accomodation, 7 More...
Aircraft Charter, Cruises, Hotels and Accomodation, Limousines, Luggage, Taxis and Chauffeurs, Tours, Travel Agents, Vacation Packages, Vehicle Rental
Currently TrendingMore...
Recent Searches
Newest Featured
Add a site
Chamomile Care - We provide independent professional home care services to people in their own homes, the environment that they are most comfortable with. We specialise in dementia care within Oxfordshire.
Chamomile Care
We provide independent professional home care services to people in their own homes, the environment that they are most comfortable with. We specialise in dementia care within Oxfordshire.
https://www.chamomilecare.com/ Health and Fitness - More Details
Paloma Beach on Cap Ferrat - Bespoke Yacht Charter's Guide to the legendary Paloma Beach Club on the Cap Ferrat peninsula, close to Nice on the French Riviera.
Paloma Beach on Cap Ferrat
Bespoke Yacht Charter's Guide to the legendary Paloma Beach Club on the Cap Ferrat peninsula, close to Nice on the French Riviera.
https://bespokeyachtcharter.com/paloma-beach/ Travel, Vacation Packages - More Details
KOR Results - Based in San Francisco, California, KOR Results is a mental health practice specializing in treating OCD (Obsessive Compulsive Disorder) & other forms of anxiety. We work with you to understand who you are, how your OCD manifests in a day-to-day basis, and to create an individualized plan to break free from OCD and anxietys clutches. We strive to deliver our high-standard of mental health care to help you live life without OCDs permission.
KOR Results
Based in San Francisco, California, KOR Results is a mental health practice specializing in treating OCD (Obsessive Compulsive Disorder) & other forms of anxiety. We work with you to understand who you are, how your OCD manifests in a day-to-day basis, and to create an individualized plan to break free from OCD and anxietys clutches. We strive to deliver our...
https://www.korresults.com/ Health and Fitness, Mental Health - More Details
The Pagan Preacher - The Pagan Preacher is probably not what you are thinking. I am the host Richard Ravenbrook. A man, a life coach and spiritual mentor who has endeavered to find real spiritual truth and self enlightenment.
The Pagan Preacher
The Pagan Preacher is probably not what you are thinking. I am the host Richard Ravenbrook. A man, a life coach and spiritual mentor who has endeavered to find real spiritual truth and self enlightenment.
https://www.thepaganpreacher.com Computers and Internet, Podcasts - More Details
Projektowanie, tworzenie sklepów internetowych | Design Cart - Polish company that creates advanced online stores in responsive technology.
Projektowanie, tworzenie sklepów internetowych | Design...
Polish company that creates advanced online stores in responsive technology.
https://www.designcart.pl/ Computers and Internet, Web Design and Development - More Details
Recent social activity
View more
Luire Jewells activated a new listing for Shop 14 Karat Gold Earrings Online
Tuesday, May 28th, 2024 at 2:33pm
mewad bhavan palitana joined the team as a Viesearch editor!
Mewad Bhavan in Palitana, Gujarat, is a renowned structure primarily known for its architectural significance and historical importance. Palitana itself is famous for its cluster of Jain temples atop Shatrunjaya Hill, making it a significant pilgrimage site for Jains.
Tuesday, May 28th, 2024 at 2:23pm
Nasir Chaudhary activated a new listing for Oaklynn Kidswear: Pioneering Children’s Fashion in...
Tuesday, May 28th, 2024 at 2:20pm
arbaz updated their profile picture
Tuesday, May 28th, 2024 at 2:09pm
Meghna Sheth activated a new listing for Best Dentist in Ahmedabad
Tuesday, May 28th, 2024 at 2:07pm
Recently Viewed Listings
gagolfers - here at gagolfers we review and test various golf productsjollys wedding photography - Jolly\'s wedding Photography one of the leading wedding photography service providers from the shore of the Arabian sea with years of tradition to capture the most touching moments of life. Improve Product Photography - Professional photography improving and service providing . Seek Assistance For Car Electrical Service At Almelhem Auto - Our company provides the best quality Auto electrical services in Dubai. Our company works with professionals who have a good amount of experience and knowledge in dealing with modern electrical systems of vehicles.NY Wedding Photographers - An imaginative wedding photographer with the ability to create unique and breathtaking photographs beyond expectations. We photograph your wedding in a style that reflects your love, romance, hopes, and dreams. We take the time to get to know you, then help you realize the true story of your special day in photographs. Let Edwin Ochoa Photography capture the romance, excitement and joy of your wedding day. A wedding is a once in a lifetime experience.
Top-notch Car Repairs In Dubai - Has your Land Rover or Range Rover not been repaired or serviced for a long time now? Bring your car to Almelhem auto services for availing top-class car repairing by experienced mechanics in technologically advanced garages. Middle-market Brands Deserve Access to DSP Tech - Middle market brands deserve access to the same technology used by the bigger spenders, and have just as much to benefit from its adoption. Brands of every size can realize real performance gains through better audience targeting and access to more comprehensive and diversified supply. And rather than be forced into agency relationships for lack of options, brands should be able to decide exactly what balance of self-service and managed service best suits their needs. Agencies should embrace...Christen Conner Personal Training - Personal Training in Maui, Taking your fitness goals and turning them into a reality with customized 1 on 1 personal training, nutritional guidance, online programs, etc. In person training performed at Maui Powerhouse Gym in Kihei. Call today to set up a complimentary consultation with Christen at 928.848.2397MOT Test Scunthorpe - LOU'S TYRES LTD provides trustworthy MOT Services in Scunthorpe at a very affordable amount. If you live in or around Leicestershire, Norfolk, Lincolnshire, or Cambridgeshire, you can visit our workshop for the MOT test. Our technicians are certified and have years of experience in handling an MOT check. Along with MOT Scunthorpe, we also offer all types of garage services.Prestige Lakeside Habitat - Prestige Lakeside Habitat is the latest upcoming residential apartment project in the rapidly developing neighbourhood of Varthur Road, Bangalore - by Prestige Group. This residential project located in East Bangalore features the very best in Prestige's signature luxury, safety, facilities, and a host of other essentials packaged with beautiful landscapes all around. The apartments are skilfully designed by top-rated Architects of the industry to deliver the best living spaces to its inhabitant
Recently Active Editors
uniathena5theoaklynnkelvinash05fbsplargiegcc
dhruvautoaiddelvehealthdikshaplakshitadrwilliam466
Random Editor

On Target Courier
Top Featured
Add a site
Antisan Yacht - Antisan is 33m motor yacht based in Cannes in the south of France. The yacht is available to charter by the day, week or longer. Antisan sleeps up to 11 guests in 5 cabins. The yacht has a fabulous crew, including an amazing Chef. Unlike other charter yachts, Antisan is not limited to 12 guests when cruising. She is legally allowed to cruise in daylight hours with up to 40 people onboard. This makes Antisan the ideal yacht for day charters for large groups, as well as weddings and...
Antisan Yacht
Antisan is 33m motor yacht based in Cannes in the south of France. The yacht is available to charter by the day, week or longer. Antisan sleeps up to 11 guests in 5 cabins. The yacht has a fabulous crew, including an amazing Chef. Unlike other charter yachts, Antisan is not limited to 12 guests when cruising. She is legally allowed to cruise in daylight hours with up to...
https://bespokeyachtcharter.com/antisan/
Expires on Monday, February 8th, 2044 Sports and Recreation, Boating - More Details
Madison Liquidators - Looking for office furniture for your business or home? Check out Madison Liquidators for an extensive collection of office chairs, desks, conference tables, file cabinets, and much more. Enjoy the convenience of direct shipping to your doorstep.
Madison Liquidators
Looking for office furniture for your business or home? Check out Madison Liquidators for an extensive collection of office chairs, desks, conference tables, file cabinets, and much more. Enjoy the convenience of direct shipping to your doorstep.
https://madisonliquidators.com/
Expires on Tuesday, July 22nd, 2042 Home, Furniture - More Details
MMA Podcast | Coupons - Welcome to our MMA podcast based in Chicago, where we explore the fine line between serious and ridiculous. Join us as we delve into the world of mixed martial arts and share our unique insights and perspectives.
MMA Podcast | Coupons
Welcome to our MMA podcast based in Chicago, where we explore the fine line between serious and ridiculous. Join us as we delve into the world of mixed martial arts and share our unique insights and perspectives.
http://mmanuts.com/
Expires on Saturday, July 27th, 2041 Sports and Recreation, Boxing and MMA - More Details
Comfyhome Heating & Cooling Melbourne - Comfyhome Specialised in gas ducted heating, evaporative cooling, split system and air conditioning installation, service and repairs. ComfyHome adheres to a customer-centric approach in a bid to provide premium heating and cooling solutions that fulfill your needs and align with your budget. We bring you convenience, affordability, and quality of service you won't find anywhere else.
Comfyhome Heating & Cooling Melbourne
Comfyhome Specialised in gas ducted heating, evaporative cooling, split system and air conditioning installation, service and repairs. ComfyHome adheres to a customer-centric approach in a bid to provide premium heating and cooling solutions that fulfill your needs and align with your budget. We bring you convenience, affordability, and quality of service you won't find...
https://www.comfyhome.com.au
Expires on Friday, July 12th, 2041 Home, Heating and Cooling - More Details
Office Furniture - Madison Liquidators is a nationwide distributor of new performance laminate, veneer and solid wood office furniture. Visit us for great deals at liquidation prices!
Office Furniture
Madison Liquidators is a nationwide distributor of new performance laminate, veneer and solid wood office furniture. Visit us for great deals at liquidation prices!
https://www.madisonliquidators.com/office-furniture/
Expires on Wednesday, May 15th, 2041 Home, Furniture - More Details
© 2004-2024 Viesearch. 16 Hudson Ave #3201, Glens Falls, NY 12801   Auctions   Terms   Privacy   RSS