Viesearch
Viesearch - Human Powered Search Engine
593,359,303 Searches  3,387,799 Submissions  860,159 Sites  4,915 Featured  1,083 Categories  327,612 Editors
Newest Featured
Horwitz, Horwitz & Associates has represented injured people in Illinois since 1924. We have experience in all personal injury cases, including motorcycle accidents. We understand how devastating a motorcycle accident can be. That’s why our. Joliet personal injury lawyers are committed to fighting for the best possible outcome for our clients. We will...
Free science fiction. Fifty-three thousand words of high-energy philosophical, theological and cosmological investigations of Quantum Monism, dimensional relationships and Multiverse in science fiction.
Mezzanine Floor, Racking and Shelving Suppliers in Berskhire, Hounslow, Slough, Maidenhead, Reading, Bristol, Newbury, Hungerford, Chippenham and London on the m4 corridor.
Become a successful Salesforce certified professional with our placement assistance included Salesforce course in Hyderabad. CRS Info Solutions is the best place in Ameerpet, Hyderabad to get job-oriented salesforce training.
Based in Essex, Search Media Group are becoming one of the fastest growing lead generation agencies. Our work is designed to generate you fresh leads and to fill up your calendar.
Recent social activity
ELV Plastering activated a new listing and submitted a new listing for review
Tuesday, June 4th, 2024 at 9:58pm
cosmetologycoza joined the team as a Viesearch editor!
Welcome to Cosmetology! Our goal was to create a lovingly curated destination site that offers the latest beauty products and skincare trends from around the world to beauty-forward men and women, globally.
Tuesday, June 4th, 2024 at 9:38pm
Tuesday, June 4th, 2024 at 9:29pm
Bill Nation submitted a new listing for review
Tuesday, June 4th, 2024 at 9:21pm
Bill Nation joined the team as a Viesearch editor!
Reduce Your Marketing Budget And Increase ROI We build revenue generating systems for each market we work in from B2C to B2B.
Tuesday, June 4th, 2024 at 9:15pm
Recently Viewed Listings
Porsche Service Center Dubai - Looking for the best Porsche Service Center in Dubai for car repairs? Our certified technicians will help ensure the best performance from your coveted Porsche.Barcelona Reality VR - We are specialists in Virtual Reality, carrying out all kinds of projects no matter how challenging it may be. - Video game - Interiors / Construction - Medical training - Educational - Interactive environments - Simulation of products -Show room - VR applications for therapies - Prototypes If you are interested in developing an application or video game for virtual reality, do not hesitate to conDedicated Server Space at HostCats Bangalore - Secure dedicated server space in Bangalore at HostCats. Elevate performance and reliability with our robust infrastructure.Magento 3rd Party Integration Service | MageComp - Increase efficiency of your Magento store by integrating fully functional and flexible 3rd Party software with Magento 3rd Party Integration Service by MageComp.
WR Gaming - WR Gaming is a South Africa-based company specializing in unique, custom-build Simulators and Gaming equipment rentals. At WR Gaming Simulators we believe that our simulator business is all about helping brands and upcoming talent in the Motor Sport Industry to use our simulators as experiential marketing tools. We aim to create the ultimate platform for gamers to compete and have a memorable entertainment experience.  WR Gaming constantly push boundaries in sim rig building and it is a...
Arcade Depot - Retro Arcade Machines - Retro arcade machines for home and commercial use. Designed and built in the UK. All arcade machines are built to order. Including cocktail table arcades and full sized upright arcade machines.Exit Strategy Games - Although I was born and raised in Sacramento, it was in Louisiana, of all places, that I tried my first escape room. The front desk staff of the hotel I was staying in asked my group if we were looking for things to do. They suggested we try an escape room near us. My first thought was, whats an escape room? and my second thought was what the hell, lets give it a shot.Keene Systems, Inc.: Best FileMaker Pro Developer - One of the most widely used database systems for businesses is FileMaker Pro. This program is using many organizations for managing their digital assets. Strong, highly scalable FileMaker Pro database systems from Keene Systems fulfill your requirements with their highly skilled developers.Get The Best Short Domain Name For Your Business - Get.tech - Using clever algorithms & Artificial Intelligence, our domain name generator generates a short and attractive brandable business name for your brand.Managed IT Support Company Virginia - TCI is a managed IT Support company in Virginia that offers a security system and unified communication solution to operate your business securely. Call us today!
Recently Active Editors
mmtrekvhinzbornlthomasldoctoratewazeslot
lbm_solutionscolliercountygarageveteransmikealreendappideas
Random Editor
Top Featured
Antisan is 33m motor yacht based in Cannes in the south of France. The yacht is available to charter by the day, week or longer. Antisan sleeps up to 11 guests in 5 cabins. The yacht has a fabulous crew, including an amazing Chef. Unlike other charter yachts, Antisan is not limited to 12 guests when cruising. She is legally allowed to cruise in daylight hours with up to...
Looking for office furniture for your business or home? Check out Madison Liquidators for an extensive collection of office chairs, desks, conference tables, file cabinets, and much more. Enjoy the convenience of direct shipping to your doorstep.
Expires on Tuesday, July 22nd, 2042 Home, Furniture - More Details
Welcome to our MMA podcast based in Chicago, where we explore the fine line between serious and ridiculous. Join us as we delve into the world of mixed martial arts and share our unique insights and perspectives.
Expires on Saturday, July 27th, 2041 Sports and Recreation, Boxing and MMA - More Details
Comfyhome Specialised in gas ducted heating, evaporative cooling, split system and air conditioning installation, service and repairs. ComfyHome adheres to a customer-centric approach in a bid to provide premium heating and cooling solutions that fulfill your needs and align with your budget. We bring you convenience, affordability, and quality of service you won't find...
Expires on Friday, July 12th, 2041 Home, Heating and Cooling - More Details
Madison Liquidators is a nationwide distributor of new performance laminate, veneer and solid wood office furniture. Visit us for great deals at liquidation prices!