Viesearch
Viesearch - Human Powered Search Engine
595,501,614 Searches  3,392,245 Submissions  860,630 Sites  4,928 Featured  1,083 Categories  329,181 Editors
Recent Searches
Newest Featured
Online shop with low cost products and free fast shipping
Goldleaf Law is a law firm of wrongful death personal injury, and civil litigation lawyers. At Goldleaf, you are a member of our team. You are seen, you are heard, you are considered, every step of the way. Our attorneys put their heads and hearts together on every case, to come up with the best approach and results for our clients.
Need Christian translation? Christian Lingua has translated over 35 million words into 139 languages for 2000+ Christian clients since 2006. Our clients include CBN, Rick Warren, Gateway Church, OneHope, HeartCry, and many others. Start your Christian translation project today with the Christian company you can trust!
Your trusted partner for top-tier Appliance Repair and Installation Services spanning the entire Canadian landscape. With a dedicated team of skilled technicians, we specialize in diagnosing and resolving a wide range of appliance issues, ensuring seamless installations for new equipment.
Lightflows is a mobile app development company, an agency you can trust with your project. We provide several app development services, including native and hybrid app development, including React Native and Ionic. With an experienced in-house app design team, you can have confidence that we can deliver complex app projects quickly and efficiently. We can help you navigate...
Recent social activity
Pwf Studio activated a new listing for Pwf Studio
Monday, June 17th, 2024 at 12:25pm
virtual joined the team as a Viesearch editor!
Get professional legal advice for your Delhi, Gurugram company! For free, our Virtual Legal Officer will meet with you for one hour to discuss any questions you may have about the law.
Monday, June 17th, 2024 at 12:11pm
Lyrix Danarius submitted a new listing and activated a new listing for Sauna Heaters & Control Panels - Swimming Pool...
Monday, June 17th, 2024 at 12:08pm
Monday, June 17th, 2024 at 11:51am
vtest submitted a new listing
Monday, June 17th, 2024 at 11:12am
Recently Viewed Listings
NexDeal - Nexdeal is an online platform that offers wholesale products in bulk quantities. It features daily deals that range from skincare products to electronic products. The products offered here are available at the lowest price on the market. Ecommerce websites or store owners purchase products in bulk quantity from Nexdeal and sell them at great profits. Nexdeal provide shipping all over the USA.Leading Steel Sheet and Coil Manufacturing Company in India | Gaurang Products Pvt. Ltd - Gaurang Products specialises in steel fabrication & sheet metal manufacturing. We're a top steel manufacturing company in India, delivering quality products across the globe.Ringing ears - May help and shut off buzzing,  hissing and roaring sounds in your ears with Tinnitus 911. Read reviews and buy Tinnitus 911 online at PhtyAge Labs and Amazon.Pixie Dusted - We are Pixie Dusted, a party princess entertainment company dedicated to creating magic one smile at a time. Our high-quality customer service, attention to details, low prices, and magic make us the best option for children's parties. We recently added two subdivisions to our company; a princess boutique and a Disney travel agency. Access our site to learn more!Best graphic design company in trichy - We Make Affordable Websites ! With Stunning Results ! Helped Thousands of Small Business Achieve New Heights. Kloudoz,  a leading web design and outsourcing company provides web design,  web development,  domain registration,  website hosting,  e-commerce solutions,  web promotion,  logo design,  Mobile apps,  SEO,  Digital Marketing,  and Brand Promotion multimedia presentation. We are a professionally managed creative web solutions company thriving on the latest web technologies.
Liquid Filling Machines - Ranging from free flowing liquid products to very viscous or even thick products,  liquid filling machines offered by Accutek can accommodate almost all types of liquid products.Vancouver Painting Company - Residential and Commercial Painters - BC Proud Painting, a highly esteemed and renowned painting company based in Vancouver, embodies the essence of painting excellence. With unparalleled craftsmanship and meticulous attention to detail, our team of professional house painters takes great pride in transforming homes and spaces into breathtaking works of art. When it comes to interior painting in Vancouver, our commitment to delivering only the best remains unwavering. Our dedicated team strives to provide exceptional...Mihopulos Piano Tuning - Address: 10123 N Spruce Ln, Mequon, WI 53092, USA || Phone: 414-315-4182Carpet Installation Service Richardson TX  - Looking for Best Carpet Repair in Richardson TX? Let us handle your old carpets if your damaged carpet has holes and bulges or tears. With been in carpet installation and repair business for around 35 years we have mastered the craft of repairing, installing or patching carpets and giving them new life.  

If you are looking for Carpet Installation Near Me in Richardson TX we are just one call away. Wayanad tour packages - Ayanad,  one of the most celebrated districts of Kerala has been presented as an ideal location for eco-tourism in India. Spread over a width of 2,132 Esq,  Wayanad lies in the lap of the majestic mountains of Western Ghats. Blessed with beauty,  serenity and tranquility,  Wayanad is one of the most
Recently Active Editors
traderedsleenacvafckennesawgapitchpinemediakitoinfocom1
jblacademyloscompadresbarsatbirbhullarajparkesrbt123456
Random Editor
Top Featured
Antisan is 33m motor yacht based in Cannes in the south of France. The yacht is available to charter by the day, week or longer. Antisan sleeps up to 11 guests in 5 cabins. The yacht has a fabulous crew, including an amazing Chef. Unlike other charter yachts, Antisan is not limited to 12 guests when cruising. She is legally allowed to cruise in daylight hours with up to...
Looking for office furniture for your business or home? Check out Madison Liquidators for an extensive collection of office chairs, desks, conference tables, file cabinets, and much more. Enjoy the convenience of direct shipping to your doorstep.
Expires on Tuesday, July 22nd, 2042 Home, Furniture - More Details
Welcome to our MMA podcast based in Chicago, where we explore the fine line between serious and ridiculous. Join us as we delve into the world of mixed martial arts and share our unique insights and perspectives.
Expires on Saturday, July 27th, 2041 Sports and Recreation, Boxing and MMA - More Details
Comfyhome Specialised in gas ducted heating, evaporative cooling, split system and air conditioning installation, service and repairs. ComfyHome adheres to a customer-centric approach in a bid to provide premium heating and cooling solutions that fulfill your needs and align with your budget. We bring you convenience, affordability, and quality of service you won't find...
Expires on Friday, July 12th, 2041 Home, Heating and Cooling - More Details
Madison Liquidators is a nationwide distributor of new performance laminate, veneer and solid wood office furniture. Visit us for great deals at liquidation prices!