Viesearch
Viesearch - Human Powered Search Engine
595,143,801 Searches  3,391,836 Submissions  860,604 Sites  4,929 Featured  1,083 Categories  329,076 Editors
Recent Searches
Newest Featured
Goldleaf Law is a law firm of wrongful death personal injury, and civil litigation lawyers. At Goldleaf, you are a member of our team. You are seen, you are heard, you are considered, every step of the way. Our attorneys put their heads and hearts together on every case, to come up with the best approach and results for our clients.
Need Christian translation? Christian Lingua has translated over 35 million words into 139 languages for 2000+ Christian clients since 2006. Our clients include CBN, Rick Warren, Gateway Church, OneHope, HeartCry, and many others. Start your Christian translation project today with the Christian company you can trust!
Your trusted partner for top-tier Appliance Repair and Installation Services spanning the entire Canadian landscape. With a dedicated team of skilled technicians, we specialize in diagnosing and resolving a wide range of appliance issues, ensuring seamless installations for new equipment.
Lightflows is a mobile app development company, an agency you can trust with your project. We provide several app development services, including native and hybrid app development, including React Native and Ionic. With an experienced in-house app design team, you can have confidence that we can deliver complex app projects quickly and efficiently. We can help you navigate...
Dislocation Density Function Dynamics, DDFD, developed by Alfonso Hing-wan Ngan (顏慶雲教授) is a highly efficient method for simulating microstructures at the meso-scale. Source code in Matlab for dislocation plasticity simulation is available for request or download.
Recent social activity
Knowledge Sourcing submitted a new listing, edited, and activated a new listing for Technology Breakthrough: Apple Paves Way for Innovations...
Saturday, June 15th, 2024 at 2:47pm
EF Douglas submitted a new listing and activated a new listing for Seawall Design services in St Kitts, Caribbean | EFD
Saturday, June 15th, 2024 at 1:22pm
Mtandt Limited submitted a new listing and activated a new listing for The Vital Role of Training and Certification for...
Saturday, June 15th, 2024 at 12:52pm
Meetanshi submitted a new listing and activated a new listing for Best Shopify Apps to Skip Cart Page and Boost Checkout
Saturday, June 15th, 2024 at 12:22pm
Recently Viewed Listings
A Complete Guide to Mobile App Testing - Since the mobile industry has been increasing in demand consistently. Mobile app testing is an important part of the app development process that will ensure your mobile app development service performs flawlessly. For this, Check out a complete guide to mobile app testing with the involved costs and diverse testing types.Best Web Design & Development Company - Subraa is one of the fastest growing website design company in Singapore. We specialize in high end websites and web applications. E commerce sites and web development. We ensure the outstanding SEO friendly web design services in Australia that aids the business to flourish with a worldwide identity. Explore our services and develop a strong position for your business over the web. We show you the way through which your business go ahead accumulating the optimistic features.Everest Base Camp Hiking - Everest Base Camp Trekking,  lodge to lodge stay trip to world's most desired trekking destination,  cheap price and bucket list of services. Book online now!The Quartz Dharamshala - The Quartz Dharamshala one of the most popular family hotel in Dharamshala,  add a spice to your vacation program with the luxury that invite you to experience a superb amalgamation of Indian cordiality and contemporary amenities. So,  indulge yourself in the luxury and comfort and explore the must see attractions at Dharamshala while you enjoy the stay at The Quartz Dharamshala.Kochi Taxi Service - Kochi Taxi 24 x 7 offers quality and best taxi cab rental service for Airport transfers, Railway Station transfer, Business cab service, Kerala Holiday Packages.
Order Now The Perfect Battery For Your Bike. - We provide the best battery for the bike all over Pune. Order now the best battery for your bike from Batterymela.World famous singer kevin jonas biography in detail - Paul Kevin Jonas II, popularly known as Kevin Jonas, is a world-famous American musician. He rose to prominence and come in limelight with the highly successful and ever-changing pop-rock Music band 'Jonas Brothers' alongside two of his brothers, Joe and Nick Jonas. Kevin is the band's lead guitarist, also sings backup music vocals as well as plays the mandolin.Dedicated server singapore, magento developer singapore - 2ezasia provides Domain name, dedicated server, magento developer, seo singapore, web ecommerce, web hosting, magento hosting, web design, Singapore web hosting at affordable prices.AreV Collection - AreV Collection is online clothing store. where you will find menswear , ladieswear and also children wear .we are only selling quality product under your budget.Nikki Sharma - We specialises in providing a wide range of digital services, including website development, UI/UX design, digital marketing, and content writing.
Recently Active Editors
wordsammarmachineryavatarluxekateamelia101rajanmodi
margaretnori233jessica_albbertlappelandadskylarmarkwilliam99
Random Editor
Top Featured
Antisan is 33m motor yacht based in Cannes in the south of France. The yacht is available to charter by the day, week or longer. Antisan sleeps up to 11 guests in 5 cabins. The yacht has a fabulous crew, including an amazing Chef. Unlike other charter yachts, Antisan is not limited to 12 guests when cruising. She is legally allowed to cruise in daylight hours with up to...
Looking for office furniture for your business or home? Check out Madison Liquidators for an extensive collection of office chairs, desks, conference tables, file cabinets, and much more. Enjoy the convenience of direct shipping to your doorstep.
Expires on Tuesday, July 22nd, 2042 Home, Furniture - More Details
Welcome to our MMA podcast based in Chicago, where we explore the fine line between serious and ridiculous. Join us as we delve into the world of mixed martial arts and share our unique insights and perspectives.
Expires on Saturday, July 27th, 2041 Sports and Recreation, Boxing and MMA - More Details
Comfyhome Specialised in gas ducted heating, evaporative cooling, split system and air conditioning installation, service and repairs. ComfyHome adheres to a customer-centric approach in a bid to provide premium heating and cooling solutions that fulfill your needs and align with your budget. We bring you convenience, affordability, and quality of service you won't find...
Expires on Friday, July 12th, 2041 Home, Heating and Cooling - More Details
Madison Liquidators is a nationwide distributor of new performance laminate, veneer and solid wood office furniture. Visit us for great deals at liquidation prices!