Viesearch
Viesearch - Human Powered Search Engine
588,002,389 Searches  3,376,122 Submissions  863,399 Sites  4,907 Featured  1,083 Categories  323,895 Editors
Recent Searches
Newest Featured
Great Image Expedition is a Travel company based in Arusha. We tailor-made genuine Tanzania Luxury Safari Tours, Mountain Climbing, and Zanzibar beach experiences according to your budget, desires, and interests. Our mode of operation is unique because we know you are unique, too. We organize the most memorable private safaris in Tanzania. Traveling with your private guide...
Magic show with live pigeons and rabbits! Be enchanted at your next party, birthday or company event with a visit from magician and entertainer Tom Trix - Children's entertainment or show for the adult audience.
Are you someone having misaligned teeth? Do you have orthodontic issues like teeth crowding, overbite, underbite, gap between teeth, etc? At Dr Joy Dental Clinic, our specialists orthodontists provide you with the best suited orthodontic treatment including various braces in Dubai like metal braces, ceramic braces, damon braces and Invisalign. Contact at 80037569 to book an...
Are you having a missing tooth? Or do you wish to get an implant after tooth extraction to fill your tooth gap? Get implants in Dubai to get back your complete smile. Dr Joy Dental Clinic provides you with implants that have 98% success rate. Contact 80037569 for bookings
If you are someone looking for a smile makeover in Dubai then Porcelain dental veneers are one of the best options you can choose to get the perfect attractive smile you always wanted. Dr Joy Dental in Dubai provides you with custom made dental veneers developed by experts at in-house dental lab.
Recent social activity
shan submitted a new listing for review
Monday, May 6th, 2024 at 2:11pm
shan joined the team as a Viesearch editor!
Certified Yoga Instructor
Monday, May 6th, 2024 at 2:08pm
Styrish AI joined the team as a Viesearch editor!
Unlock the power of machine learning with Styrishai.com online training. Master the latest techniques and elevate your career. Enroll now! www.styrishai.com/machine-learning-basics/
Monday, May 6th, 2024 at 2:06pm
Nepal Social Treks activated a new listing for PoonHill Trek
Monday, May 6th, 2024 at 2:03pm
Crocus joined the team as a Viesearch editor and claimed 1 listing!
Welcome to Crocus by the Sea in Iconic Wildwood Crest. We have 3 apartments we rent all pet friendly and 3 blocks to the beach. Our charming 1st floor 3 bed, Second floor 2 bed Sea Breeze Bay and Second floor 2 bed Ocean Serenade.
Monday, May 6th, 2024 at 1:57pm
Recently Viewed Listings
Shegerian & Associates - Shegerian & Associates is located in the City of Santa Monica. We specialize in representing employees against their employers. Our expertise are in labor and employment laws and litigation. We are dedicated to serving the legal needs of employees in the area of Disability & Worker\'s Compensation, Whistle Blowing, Sexual Harassment, Wrongful Termination, and Hostile Workplace. We are committed to representing an individual\'s rights in the workplace and have been successfully representing our..XCart to Zoho Inventory Integration - Integrate XCart to Zoho Inventory Using KloudConnectors. Syn any time and Unlimited. Stop doing manual work and automating them. Start your free trial.Hosting-247 - We offer three levels of hosting starting at £1.99 a month with a guarenteed uptime of 99% on top quality reliable servers. We will soon be offering domain name registration at unbeatable pricesCommercial Kitchen Equipments Manufacturer in Chennai - We are one of the trusted leading Commercial Kitchen Equipments Manufacturer in Chennai with top quality products. Visit us now and get exclusive equipments.Plastic Extruders - Welcome to our Plastic Extruders Factory! We offer high-quality plastic extrusion machines catering to diverse industry needs. Explore our range for top-notch solutions!
BMW Bavaria Motors - Purchase any of the BMW M arrangement models and cover long separations inside seconds. It is an extraordinary decision,  on the off chance that you consider this auto as your typical driving sidekick. Visit any dealership close you and check the cost.Facial Austin - Austin skin care expert Linda Vandermause volunteering facial,  skin care,  day spa,  waxing services and more. Linda holds certifications in waxing,  chemical peels,  dermaplaning and Microcurrent technology.Israel PrivateTours - Tourpact provides the trip of all famous Place of Israel like Jerusalem & Bethlehem,  Dead Sea and Masada,  Nazareth & Galilee and NazarethPlunge Bra to Style your Deep-Neck Tops and Dresses  - Get natural cleavage with our Plunge Bra, offering moderate coverage and perfect for deep-neck outfits. Designed to push breasts together, it creates a flattering, fuller look.Artboulle - Artboulle deals in luxury gates and doors both wooden and metal,  designer staircases and assortment of interior collections made with the finest materials.
Recently Active Editors
olive02bowieknifehalehpaasardigitalstyrishai
homeappliances3diginiravadvncroatialibsysltdfrenchbulldog4
Random Editor
Top Featured
Antisan is 33m motor yacht based in Cannes in the south of France. The yacht is available to charter by the day, week or longer. Antisan sleeps up to 11 guests in 5 cabins. The yacht has a fabulous crew, including an amazing Chef. Unlike other charter yachts, Antisan is not limited to 12 guests when cruising. She is legally allowed to cruise in daylight hours with up to...
Looking for office furniture for your business or home? Check out Madison Liquidators for an extensive collection of office chairs, desks, conference tables, file cabinets, and much more. Enjoy the convenience of direct shipping to your doorstep.
Expires on Tuesday, July 22nd, 2042 Home, Furniture - More Details
Welcome to our MMA podcast based in Chicago, where we explore the fine line between serious and ridiculous. Join us as we delve into the world of mixed martial arts and share our unique insights and perspectives.
Expires on Saturday, July 27th, 2041 Sports and Recreation, Boxing and MMA - More Details
Comfyhome Specialised in gas ducted heating, evaporative cooling, split system and air conditioning installation, service and repairs. ComfyHome adheres to a customer-centric approach in a bid to provide premium heating and cooling solutions that fulfill your needs and align with your budget. We bring you convenience, affordability, and quality of service you won't find...
Expires on Friday, July 12th, 2041 Home, Heating and Cooling - More Details
Madison Liquidators is a nationwide distributor of new performance laminate, veneer and solid wood office furniture. Visit us for great deals at liquidation prices!