Viesearch
Join Now  Sign In  
Viesearch - Human Powered Search Engine
594,230,643 Searches  3,389,419 Submissions  860,312 Sites  4,921 Featured  1,083 Categories  328,222 Editors
Arts and Entertainment (79,267)
Animation, Architecture, Art History, 29 More...
Animation, Architecture, Art History, Astrology and Horoscopes, Body Modification, Classical Studies, Comics, Crafts, Dance, Design, Entertainment, Fashion, Graphic Design, Humanities, Humor, Illustration, Literature, Movies, Music, Myths and Folktales, Native and Tribal, Online Writing, Performing Arts, Photography, Radio, Rhetoric, Television, Theatre, Typography, Video, Visual Arts, Writers Resources
Business (97,364)
Agriculture, Bookkeeping and Accounting, Construction, 31 More...
Agriculture, Bookkeeping and Accounting, Construction, Consulting, Cooperatives, Customer Service, Engineering, Event Planning, Freight Brokerage and Transportation, Human Resources, Industrial, Information Services, International Business and Trade, Life Coaching, Locksmiths, Major Companies, Management, Manufacturing, Messengers and Couriers, Mining, Opportunities, Outsourcing, Painting Services, Personal and Virtual Assistants, Point of Sale Hardware and Systems, Private Investigation, Publishing and Printing, Security Services, Small Business, Telecommunications, Transcription Services, Translation Services, Waste Management and Recycling, Work At Home
Computers and Internet (88,327)
Algorithms, Artificial Intelligence, Chats and Forums, 29 More...
Algorithms, Artificial Intelligence, Chats and Forums, Computer Repair, Computer Science, Cyberculture, Data Backup, Data Recovery, Desktop and Mobile Wallpapers, Desktop Publishing, Domain Names, E-Commerce, Freelancers, Hardware, Internet, Mobile Computing, Open Source, Operating Systems, Podcasts, Portal, Programming, Robotics, Search Engines, Security, Social Networking, Software, Systems, Technical Guides and Support, Virtual Reality, Web Design and Development, Web Hosting, Webmaster Resources
Games (7,447)
Board Games, Card Games, Coin-Op, 17 More...
Board Games, Card Games, Coin-Op, Computer Games, Dice, Flash Game Arcades, Hand Games, Hand-Eye Coordination, Miniatures, Mobile Games, Online, Paper and Pencil, Party Games, Play-By-Mail, Puzzles, Roleplaying, Tile Games, Trading Card Games, Video Games, Yard, Deck, and Table Games
Health and Fitness (72,415)
Aging, Allergies, Alternative, 45 More...
Aging, Allergies, Alternative, Anaesthesiology, Animal, Ayurveda, Beauty, Cardiology, Child Health, Chiropractic, Clinical Research, Conditions and Diseases, Cosmetic Surgery, Dental, Dermatology, Diagnostic Imaging, Disabilities, DNA Testing, First Aid, Fitness, Healthcare Industry, Hearing and Audiology, Home Health Care, Homeopathy, Hygiene, Massage Therapy, Medical Billing, Medical Equipment, Medical ID Bracelets, Medicine, Mental Health, Nephrology, Neurology, Nursing, Nutrition, Obstetrics and Gynecology, Oncology, Ophthalmology and Optometry, Orthopedics, Otorhinolaryngology, Pain Management, Physical Therapy, Physiotherapy, Podiatry, Rheumatology, Senior Care, Urology, Weight Loss
Home (110,492)
Apartment Living, Appliance Repair, Asbestos Removal, 42 More...
Apartment Living, Appliance Repair, Asbestos Removal, Bathroom, Carpeting and Flooring, Chimney Cleaning, Cleaning Services, Cooking, Do-It-Yourself, Domestic Services, Electricians, Emergency Preparation, Entertaining, Family, Fences, Furniture, Garage, Heating and Cooling, Home and Office Safety, Home Automation, Home Business, Home Improvement, Home Restoration and Repair, Homemaking, Homeowners, Interior Design, Kitchen, Laundry and Dry Cleaning, Lighting, Packers and Movers, Personal Finance, Personal Organization, Pest Control, Pets, Plumbing, Roofs and Gutters, Rural Living, Security, Seniors, Storage, Swimming Pools and Spas, Tree Cutting and Removal, Urban Living, Windows and Siding, Yard and Garden
Jobs and Employment (6,065)
Accountancy, Administration, Airport, 21 More...
Accountancy, Administration, Airport, Background Screening, Banking, Call Center, Civil Service, Construction, Customer Service, Driving, Fashion Design, Finance, Hospitality, Marketing, Office, Online Jobs, Part Time, Recruitment Agencies, Resume Writing, Retail, Sales, Teaching, Teaching Assistant, Warehouse
Kids and Teens (7,264)
Arts, Babies, Childcare, 6 More...
Arts, Babies, Childcare, People and Society, Pre-School, School Time, Sports and Hobbies, Teen Life, Your Family
Marketing and Advertising (32,615)
Agencies, Banner Exchange, Directories, 12 More...
Agencies, Banner Exchange, Directories, Forum Posting Services, Link Building, Magazine, Newspaper, Outdoor, Pay Per Click, Promotional Products, Search Engine Optimization, Signage, Television, Trade Show Displays, Traffic Exchange
News (20,044)
Current Events, Internet Broadcasts, Journals, 4 More...
Current Events, Internet Broadcasts, Journals, Magazines and E-zines, Newspapers, Television, Weather
Real Estate (29,173)
Apartment Rentals, Appraisers and Consultants, Brokerages, 10 More...
Apartment Rentals, Appraisers and Consultants, Brokerages, Commercial, Coworking and Office Space, Farm Land, For Sale By Owner, Home Inspection, Plots and Land For Sale, Property Management, Realtors, Residential Projects, Timeshare
Reference and Education (77,307)
Advice, Almanacs, Articles, 17 More...
Advice, Almanacs, Articles, Bibliography, Biography, Blogs, College and University, Education and Training, Educational Resources, Encyclopedias, Genealogy, History, Knowledge Management, Libraries, Living History, Maps, Museums, Resources, Thesauri, World Records
Regional (21,596)
Africa, Argentina, Armenia, 39 More...
Africa, Argentina, Armenia, Asia, Australia, Austria, Brazil, Canada, Caribbean, Central America, Croatia, Czech Republic, Denmark, Europe, Finland, Germany, Greece, Hong Kong, India, Indonesia, Ireland, Israel, Italy, Japan, Lithuania, Middle East, Netherlands, New Zealand, North America, Norway, Oceania, Philippines, Polar Regions, Puerto Rico, Russia, Slovakia, South America, Sweden, Taiwan, United Kingdom, United States, Zimbabwe
Science (9,009)
Aerospace and Aeronautics, Astronomy, Biology, 19 More...
Aerospace and Aeronautics, Astronomy, Biology, Chemistry, Conferences, Earth Sciences, Environment and Nature, Geology and Geophysics, Institutions, Instruments and Supplies, Mathematics, Methods and Techniques, Museums, Nanotechnology, News and Media, Physics, Publications, Reference, Renewable Energy, Science in Society, Technology, Wildlife
Shopping (105,378)
Antiques, Appliances, Art Supplies, 22 More...
Antiques, Appliances, Art Supplies, Auctions, Autos, Beauty Products, Books, Classifieds, Clothing and Shoes, Coupons and Deals, Electronics, Flowers, Food and Beverage, Gifts, Glassware, Greeting Cards, Jewelry, Mobile Phones, Motorcycles, Office Products, Sporting Goods, Tickets, Tools and Hardware, Toys, Wholesale
Society (30,675)
Activism, Crime, Death, 26 More...
Activism, Crime, Death, Disabled, Economics, Ethnicity, Folklore, Future, Holidays, Issues, Language and Linguistics, Law, Lifestyle Choices, Men, Military, Organizations, Paranormal, People, Philanthropy, Philosophy, Roads and Highways, Social Sciences, Sociology, Subcultures, Support Groups, Trains and Railroads, Urban Legends, Weddings, Women
Sports and Recreation (24,765)
Archery, Audio and Radio, Aviation, 55 More...
Archery, Audio and Radio, Aviation, Badminton, Baseball, Basketball, Billiards, Birding, Boating, Bowling, Boxing and MMA, Camps, Climbing, Coaching, Collecting, Crafts, Cricket, Cycling, Disabled, Events, Extreme Sports, Fantasy, Fishing, Football, Geocaching, Golf, Hang Gliding, Hockey, Horseracing, Kites, Knives, Lacrosse, Martial Arts, Models, Motorsports, Organizations, Outdoors, Paintball, Parties, People, Rugby, Running, Scouting, Scuba Diving, Skateboarding, Skating, Soccer, Surfing, Swimming, Table Tennis, Team Spirit, Tennis, Theme Parks, Track and Field, Volleyball, Weight Lifting, Winter Sports, Wrestling
Travel (41,109)
Aircraft Charter, Cruises, Hotels and Accomodation, 7 More...
Aircraft Charter, Cruises, Hotels and Accomodation, Limousines, Luggage, Taxis and Chauffeurs, Tours, Travel Agents, Vacation Packages, Vehicle Rental
Currently TrendingMore...
Recent Searches
Newest Featured
Add a site
iROOMit Roommate finder & Rooms for rent - Roommates save, hosts earn. Make any city your home with our Instant Room Rentals!
iROOMit Roommate finder & Rooms for rent
Roommates save, hosts earn. Make any city your home with our Instant Room Rentals!
https://www.iroomit.com/ Home, Apartment Living - More Details
Web design agency Guildford, Surrey - As a leading web design agency in Guildford, we specialize in bespoke web design, web development, e-commerce solutions, and SEO optimisation, ensuring your online presence is as effective as possible. Whether you're a startup looking to establish a digital footprint or an established company aiming to revamp your online strategy, our Guildford based web agency is here to help you achieve your goals.
Web design agency Guildford, Surrey
As a leading web design agency in Guildford, we specialize in bespoke web design, web development, e-commerce solutions, and SEO optimisation, ensuring your online presence is as effective as possible. Whether you're a startup looking to establish a digital footprint or an established company aiming to revamp your online strategy, our Guildford based web agency is here to...
https://www.lightflows.co.uk Marketing and Advertising, Agencies - More Details
My Kitchen and Bath - Kitchen and Bath Remodeling in Virginia, Maryland & Washington DC
My Kitchen and Bath
Kitchen and Bath Remodeling in Virginia, Maryland & Washington DC
https://mykitchenandbath.com/ Home, Kitchen - More Details
Salesforce training institute in Pune - CRS Info Solutions stands out as one of the premier Salesforce training institutes in Pune, renowned for our project-based, hands-on courses. We offer top-notch Salesforce online training, delivered by real-time, highly experienced instructors in Pune, Maharashtra.
Salesforce training institute in Pune
CRS Info Solutions stands out as one of the premier Salesforce training institutes in Pune, renowned for our project-based, hands-on courses. We offer top-notch Salesforce online training, delivered by real-time, highly experienced instructors in Pune, Maharashtra.
https://www.crsinfosolutions.com/salesforce-training-cost-in-pune/ Reference and Education, Education and Training - More Details
Ripley Hypnotherapy Derbyshire office - Ripley hypnotherapy are a Derbyshire based professional hypnotherapist service. Offering help to stop smoking, beat depression, lose weight, stop anxiety and panic attacks, improve public speaking and much more with weight loss being the main speciality. We offer evening and weekend appointments so we can always try and fit you in. Call for your free consultation
Ripley Hypnotherapy Derbyshire office
Ripley hypnotherapy are a Derbyshire based professional hypnotherapist service. Offering help to stop smoking, beat depression, lose weight, stop anxiety and panic attacks, improve public speaking and much more with weight loss being the main speciality. We offer evening and weekend appointments so we can always try and fit you in. Call for your free consultation
http://ripley-hypnotherapy.co.uk Health and Fitness, Alternative - More Details
Recent social activity
View more
Theautopartsshop activated a new listing and tagged Household Shop And Office Products
discount auto parts store
Sunday, June 9th, 2024 at 1:04pm
Akshay activated a new listing and submitted a new listing for review
Sunday, June 9th, 2024 at 12:35pm
Adventure Gears joined the team as a Viesearch editor!
TheAdventureGears is an online retailer, located in the north west of Montana, that specializes in providing high-quality outdoor equipment for adventurers of all levels.
Sunday, June 9th, 2024 at 12:14pm
Legalcy Private Limited joined the team as a Viesearch editor!
LEGALCY PRIVATE LIMITED. Is Registered Company Since 2021 From The Ministry of Corporate Affairs (MCA), Government of India, A Legal Licensing and Registration Consultants Company.
Sunday, June 9th, 2024 at 12:13pm
Ashesh Shah Photography LLP activated a new listing for Expert Industrial Photography Services in Mumbai -...
Sunday, June 9th, 2024 at 12:11pm
Recently Viewed Listings
Leading - Settle is a prominent fintech company specialising in Settlement and Settlement services. Our advanced solutions are designed to assist ...Best Labor Law Posters For State and Federal - Best Labor Law Posters offers up-to-date state and federal labor law compliance posters for 2023-2024.Datta Homes is a new home builder in Seattle, Washington - Datta Homes is a new home builder in Seattle, Washington offering modern new homes for sale in Washington State’s most desirable locations.Graphic Novel Illustrations - Best Animation Studios' professional illustrators create stunning GRAPHIC-NOVEL ILLUSTRATIONS and animations. Look no further! Contact us now.The Resume Bawse - Fast, efficient, and honest, The Resume Bawse has become a reputable and well-known Resume Service. With over 9+�years of military experience providing world class administrative services to the top executives, our team is up for every job. Our resume format works for all level of job opportunities including freelance, remote, local, state, and government jobs. We want our customers to be satisfied with our work, which is why we provide open communication channels throughout the duration of ea
Project Management Software - TimenTask is the project management platform which allows you to analyze the employee performance by providing the measures of the efforts made by them on task.Bainton Flooring - Bainton Flooring is a family-run commercial and residential flooring business established in 1963 with an office and showroom located in Bournemouth. We work extensively throughout the UK and Europe.Garage Door Repair Annapolis - When considering garage door and spring service in Annapolis, MD, Garage Door Repair Annapolis can repair all of them. We\'ve got a lot to offer you, as part of our fantastic selection you\'ll discover, Commercial metal doors, Custom carriage garage doors, Garage door installation, Garage door openers, Garage door repair, Garage spring replacement and much more. A good looking and well-functioning garage door doesn\'t only put a fantastic aesthetic to the look of your house, it can incVanquish Living - Vanquish Living is an online furniture store, proudly serving the community out of Houston, TX. Toronto Custom Home Builders - Sina Architectural Design - Leading Toronto home builder and architecture firm Sina Architectural Design specializes in building luxury homes and developing residential condominium and subdivision projects.
Recently Active Editors
rabehnelyaqasrjamalkwsgholidaystourfamilyfirst
highlandattiredemonsbehindmekalalimdavidprinceawakeny
Random Editor

Lightflows
Top Featured
Add a site
Antisan Yacht - Antisan is 33m motor yacht based in Cannes in the south of France. The yacht is available to charter by the day, week or longer. Antisan sleeps up to 11 guests in 5 cabins. The yacht has a fabulous crew, including an amazing Chef. Unlike other charter yachts, Antisan is not limited to 12 guests when cruising. She is legally allowed to cruise in daylight hours with up to 40 people onboard. This makes Antisan the ideal yacht for day charters for large groups, as well as weddings and...
Antisan Yacht
Antisan is 33m motor yacht based in Cannes in the south of France. The yacht is available to charter by the day, week or longer. Antisan sleeps up to 11 guests in 5 cabins. The yacht has a fabulous crew, including an amazing Chef. Unlike other charter yachts, Antisan is not limited to 12 guests when cruising. She is legally allowed to cruise in daylight hours with up to...
https://bespokeyachtcharter.com/antisan/
Expires on Monday, February 8th, 2044 Sports and Recreation, Boating - More Details
Madison Liquidators - Looking for office furniture for your business or home? Check out Madison Liquidators for an extensive collection of office chairs, desks, conference tables, file cabinets, and much more. Enjoy the convenience of direct shipping to your doorstep.
Madison Liquidators
Looking for office furniture for your business or home? Check out Madison Liquidators for an extensive collection of office chairs, desks, conference tables, file cabinets, and much more. Enjoy the convenience of direct shipping to your doorstep.
https://madisonliquidators.com/
Expires on Tuesday, July 22nd, 2042 Home, Furniture - More Details
MMA Podcast | Coupons - Welcome to our MMA podcast based in Chicago, where we explore the fine line between serious and ridiculous. Join us as we delve into the world of mixed martial arts and share our unique insights and perspectives.
MMA Podcast | Coupons
Welcome to our MMA podcast based in Chicago, where we explore the fine line between serious and ridiculous. Join us as we delve into the world of mixed martial arts and share our unique insights and perspectives.
http://mmanuts.com/
Expires on Saturday, July 27th, 2041 Sports and Recreation, Boxing and MMA - More Details
Comfyhome Heating & Cooling Melbourne - Comfyhome Specialised in gas ducted heating, evaporative cooling, split system and air conditioning installation, service and repairs. ComfyHome adheres to a customer-centric approach in a bid to provide premium heating and cooling solutions that fulfill your needs and align with your budget. We bring you convenience, affordability, and quality of service you won't find anywhere else.
Comfyhome Heating & Cooling Melbourne
Comfyhome Specialised in gas ducted heating, evaporative cooling, split system and air conditioning installation, service and repairs. ComfyHome adheres to a customer-centric approach in a bid to provide premium heating and cooling solutions that fulfill your needs and align with your budget. We bring you convenience, affordability, and quality of service you won't find...
https://www.comfyhome.com.au
Expires on Friday, July 12th, 2041 Home, Heating and Cooling - More Details
Office Furniture - Madison Liquidators is a nationwide distributor of new performance laminate, veneer and solid wood office furniture. Visit us for great deals at liquidation prices!
Office Furniture
Madison Liquidators is a nationwide distributor of new performance laminate, veneer and solid wood office furniture. Visit us for great deals at liquidation prices!
https://www.madisonliquidators.com/office-furniture/
Expires on Wednesday, May 15th, 2041 Home, Furniture - More Details
© 2004-2024 Viesearch. 16 Hudson Ave #3201, Glens Falls, NY 12801   Auctions   Terms   Privacy   RSS