Viesearch
Join Now  Sign In  
Viesearch - Human Powered Search Engine
589,757,555 Searches  3,381,500 Submissions  864,213 Sites  4,911 Featured  1,083 Categories  325,471 Editors
Arts and Entertainment (79,546)
Animation, Architecture, Art History, 29 More...
Animation, Architecture, Art History, Astrology and Horoscopes, Body Modification, Classical Studies, Comics, Crafts, Dance, Design, Entertainment, Fashion, Graphic Design, Humanities, Humor, Illustration, Literature, Movies, Music, Myths and Folktales, Native and Tribal, Online Writing, Performing Arts, Photography, Radio, Rhetoric, Television, Theatre, Typography, Video, Visual Arts, Writers Resources
Business (97,707)
Agriculture, Bookkeeping and Accounting, Construction, 31 More...
Agriculture, Bookkeeping and Accounting, Construction, Consulting, Cooperatives, Customer Service, Engineering, Event Planning, Freight Brokerage and Transportation, Human Resources, Industrial, Information Services, International Business and Trade, Life Coaching, Locksmiths, Major Companies, Management, Manufacturing, Messengers and Couriers, Mining, Opportunities, Outsourcing, Painting Services, Personal and Virtual Assistants, Point of Sale Hardware and Systems, Private Investigation, Publishing and Printing, Security Services, Small Business, Telecommunications, Transcription Services, Translation Services, Waste Management and Recycling, Work At Home
Computers and Internet (88,611)
Algorithms, Artificial Intelligence, Chats and Forums, 29 More...
Algorithms, Artificial Intelligence, Chats and Forums, Computer Repair, Computer Science, Cyberculture, Data Backup, Data Recovery, Desktop and Mobile Wallpapers, Desktop Publishing, Domain Names, E-Commerce, Freelancers, Hardware, Internet, Mobile Computing, Open Source, Operating Systems, Podcasts, Portal, Programming, Robotics, Search Engines, Security, Social Networking, Software, Systems, Technical Guides and Support, Virtual Reality, Web Design and Development, Web Hosting, Webmaster Resources
Games (7,508)
Board Games, Card Games, Coin-Op, 17 More...
Board Games, Card Games, Coin-Op, Computer Games, Dice, Flash Game Arcades, Hand Games, Hand-Eye Coordination, Miniatures, Mobile Games, Online, Paper and Pencil, Party Games, Play-By-Mail, Puzzles, Roleplaying, Tile Games, Trading Card Games, Video Games, Yard, Deck, and Table Games
Health and Fitness (72,707)
Aging, Allergies, Alternative, 45 More...
Aging, Allergies, Alternative, Anaesthesiology, Animal, Ayurveda, Beauty, Cardiology, Child Health, Chiropractic, Clinical Research, Conditions and Diseases, Cosmetic Surgery, Dental, Dermatology, Diagnostic Imaging, Disabilities, DNA Testing, First Aid, Fitness, Healthcare Industry, Hearing and Audiology, Home Health Care, Homeopathy, Hygiene, Massage Therapy, Medical Billing, Medical Equipment, Medical ID Bracelets, Medicine, Mental Health, Nephrology, Neurology, Nursing, Nutrition, Obstetrics and Gynecology, Oncology, Ophthalmology and Optometry, Orthopedics, Otorhinolaryngology, Pain Management, Physical Therapy, Physiotherapy, Podiatry, Rheumatology, Senior Care, Urology, Weight Loss
Home (111,162)
Apartment Living, Appliance Repair, Asbestos Removal, 42 More...
Apartment Living, Appliance Repair, Asbestos Removal, Bathroom, Carpeting and Flooring, Chimney Cleaning, Cleaning Services, Cooking, Do-It-Yourself, Domestic Services, Electricians, Emergency Preparation, Entertaining, Family, Fences, Furniture, Garage, Heating and Cooling, Home and Office Safety, Home Automation, Home Business, Home Improvement, Home Restoration and Repair, Homemaking, Homeowners, Interior Design, Kitchen, Laundry and Dry Cleaning, Lighting, Packers and Movers, Personal Finance, Personal Organization, Pest Control, Pets, Plumbing, Roofs and Gutters, Rural Living, Security, Seniors, Storage, Swimming Pools and Spas, Tree Cutting and Removal, Urban Living, Windows and Siding, Yard and Garden
Jobs and Employment (6,097)
Accountancy, Administration, Airport, 21 More...
Accountancy, Administration, Airport, Background Screening, Banking, Call Center, Civil Service, Construction, Customer Service, Driving, Fashion Design, Finance, Hospitality, Marketing, Office, Online Jobs, Part Time, Recruitment Agencies, Resume Writing, Retail, Sales, Teaching, Teaching Assistant, Warehouse
Kids and Teens (7,288)
Arts, Babies, Childcare, 6 More...
Arts, Babies, Childcare, People and Society, Pre-School, School Time, Sports and Hobbies, Teen Life, Your Family
Marketing and Advertising (32,797)
Agencies, Banner Exchange, Directories, 12 More...
Agencies, Banner Exchange, Directories, Forum Posting Services, Link Building, Magazine, Newspaper, Outdoor, Pay Per Click, Promotional Products, Search Engine Optimization, Signage, Television, Trade Show Displays, Traffic Exchange
News (20,157)
Current Events, Internet Broadcasts, Journals, 4 More...
Current Events, Internet Broadcasts, Journals, Magazines and E-zines, Newspapers, Television, Weather
Real Estate (29,504)
Apartment Rentals, Appraisers and Consultants, Brokerages, 10 More...
Apartment Rentals, Appraisers and Consultants, Brokerages, Commercial, Coworking and Office Space, Farm Land, For Sale By Owner, Home Inspection, Plots and Land For Sale, Property Management, Realtors, Residential Projects, Timeshare
Reference and Education (77,239)
Advice, Almanacs, Articles, 17 More...
Advice, Almanacs, Articles, Bibliography, Biography, Blogs, College and University, Education and Training, Educational Resources, Encyclopedias, Genealogy, History, Knowledge Management, Libraries, Living History, Maps, Museums, Resources, Thesauri, World Records
Regional (21,649)
Africa, Argentina, Armenia, 39 More...
Africa, Argentina, Armenia, Asia, Australia, Austria, Brazil, Canada, Caribbean, Central America, Croatia, Czech Republic, Denmark, Europe, Finland, Germany, Greece, Hong Kong, India, Indonesia, Ireland, Israel, Italy, Japan, Lithuania, Middle East, Netherlands, New Zealand, North America, Norway, Oceania, Philippines, Polar Regions, Puerto Rico, Russia, Slovakia, South America, Sweden, Taiwan, United Kingdom, United States, Zimbabwe
Science (9,019)
Aerospace and Aeronautics, Astronomy, Biology, 19 More...
Aerospace and Aeronautics, Astronomy, Biology, Chemistry, Conferences, Earth Sciences, Environment and Nature, Geology and Geophysics, Institutions, Instruments and Supplies, Mathematics, Methods and Techniques, Museums, Nanotechnology, News and Media, Physics, Publications, Reference, Renewable Energy, Science in Society, Technology, Wildlife
Shopping (105,981)
Antiques, Appliances, Art Supplies, 22 More...
Antiques, Appliances, Art Supplies, Auctions, Autos, Beauty Products, Books, Classifieds, Clothing and Shoes, Coupons and Deals, Electronics, Flowers, Food and Beverage, Gifts, Glassware, Greeting Cards, Jewelry, Mobile Phones, Motorcycles, Office Products, Sporting Goods, Tickets, Tools and Hardware, Toys, Wholesale
Society (31,009)
Activism, Crime, Death, 26 More...
Activism, Crime, Death, Disabled, Economics, Ethnicity, Folklore, Future, Holidays, Issues, Language and Linguistics, Law, Lifestyle Choices, Men, Military, Organizations, Paranormal, People, Philanthropy, Philosophy, Roads and Highways, Social Sciences, Sociology, Subcultures, Support Groups, Trains and Railroads, Urban Legends, Weddings, Women
Sports and Recreation (24,864)
Archery, Audio and Radio, Aviation, 55 More...
Archery, Audio and Radio, Aviation, Badminton, Baseball, Basketball, Billiards, Birding, Boating, Bowling, Boxing and MMA, Camps, Climbing, Coaching, Collecting, Crafts, Cricket, Cycling, Disabled, Events, Extreme Sports, Fantasy, Fishing, Football, Geocaching, Golf, Hang Gliding, Hockey, Horseracing, Kites, Knives, Lacrosse, Martial Arts, Models, Motorsports, Organizations, Outdoors, Paintball, Parties, People, Rugby, Running, Scouting, Scuba Diving, Skateboarding, Skating, Soccer, Surfing, Swimming, Table Tennis, Team Spirit, Tennis, Theme Parks, Track and Field, Volleyball, Weight Lifting, Winter Sports, Wrestling
Travel (41,368)
Aircraft Charter, Cruises, Hotels and Accomodation, 7 More...
Aircraft Charter, Cruises, Hotels and Accomodation, Limousines, Luggage, Taxis and Chauffeurs, Tours, Travel Agents, Vacation Packages, Vehicle Rental
Currently TrendingMore...
Recent Searches
Newest Featured
Add a site
Duravex Roofing Group - Dulux Acratex Registered Roof Applicator - We are a team of skilled and professional roofers who have been serving our clients for over two decades. Our reputation is based on the number of delighted and happy clients we have across NSW. Our aim is to provide the greatest quality workmanship, products, and customer service experience for our clients. From your first contact with us until the completion of the job, our attention is on you, the client, and ensuring that you are satisfied with your decision to hire Duravex...
Duravex Roofing Group - Dulux Acratex Registered Roof...
We are a team of skilled and professional roofers who have been serving our clients for over two decades. Our reputation is based on the number of delighted and happy clients we have across NSW. Our aim is to provide the greatest quality workmanship, products, and customer service experience for our clients. From your first contact with us until the completion of the job,...
https://www.duravex.com.au/ Home, Roofs and Gutters - More Details
Kansas City Brain Injury Attorney - Our skilled brain injury attorneys have helped victims for decades. We have a proven track record of helping victims get the damages they need so they can get proper medical care.
Kansas City Brain Injury Attorney
Our skilled brain injury attorneys have helped victims for decades. We have a proven track record of helping victims get the damages they need so they can get proper medical care.
https://www.langdonemison.com/kansas-city/brain-injury-attorney/ Regional, United States, Missouri - More Details
Best China Freight Forwarder Agent-Shipping From China To USA.UK.Amazon FBA - Introducing the leading freight forwarding service in China, specializing in delivering your goods from China's bustling manufacturing hubs to the USA, UK, and directly to Amazon FBA warehouses. As your trusted logistics partner, we ensure smooth and efficient shipping of your cargo, whether it's for personal use, business, or Amazon FBA inventory.
Best China Freight Forwarder Agent-Shipping From China...
Introducing the leading freight forwarding service in China, specializing in delivering your goods from China's bustling manufacturing hubs to the USA, UK, and directly to Amazon FBA warehouses. As your trusted logistics partner, we ensure smooth and efficient shipping of your cargo, whether it's for personal use, business, or Amazon FBA inventory.
https://china-freight-forwarders.com Business, Freight Brokerage and Transportation - More Details
United Airlines Reservation | United Airlines Customer Service | Call 1-844-480-0252 - Looking for United Airline Reservation? Booking,Changes and Cancellation on call 1-844-480-0252. 24x7 Live Agents Available.Customer service available 7 days a week.
United Airlines Reservation | United Airlines Customer...
Looking for United Airline Reservation? Booking,Changes and Cancellation on call 1-844-480-0252. 24x7 Live Agents Available.Customer service available 7 days a week.
https://www.myfaredeal.com/airlines/united-airlines Travel - More Details
Airline Reservation Desk - Airlineshelp.us - Search for Best flights Comfortable seats Top deals and destinations Airlineshelp provides to plan your trip all around the world without any problem. Get best flight deals! Book flight Baggage Help Desk Your personal and financial information stays secure with us. Airline Booking Policy Latest Fares for all major domestic & international destinations with 24x7 Customer service.
Airline Reservation Desk - Airlineshelp.us
Search for Best flights Comfortable seats Top deals and destinations Airlineshelp provides to plan your trip all around the world without any problem. Get best flight deals! Book flight Baggage Help Desk Your personal and financial information stays secure with us. Airline Booking Policy Latest Fares for all major domestic & international destinations with 24x7 Customer...
https://airlineshelp.us/ Travel, Travel Agents - More Details
Recent social activity
View more
Kirinari submitted a new listing for review
Sunday, May 19th, 2024 at 4:45am
Kirinari joined the team as a Viesearch editor!
Kirinari's a local non-profit helping people out in the community. They've been around for a while now and offer specialised services for those who need a bit of extra support.
Sunday, May 19th, 2024 at 4:41am
amir naghdi joined the team as a Viesearch editor!
we are the best education for entrance exam school
Sunday, May 19th, 2024 at 4:34am
Wrangle Jobs submitted a new listing for review
Sunday, May 19th, 2024 at 4:32am
Wrangle Jobs joined the team as a Viesearch editor!
Wrangle is the ultimate career platform designed to accelerate your job search. With Wrangle, you can create resumes, get matched with job opportunities, and apply to jobs using AI. Wrangle helps you get hired faster and makes your job search easy.
Sunday, May 19th, 2024 at 4:29am
Recently Viewed Listings
Need of Safety And Compliance - Pioneer Trucking Solutions - Trucking is the most regulated industry in Canada and the USA. Therefore, one needs to follow the safety and compliance protocol. Our expert team would provide a full overview of safety and compliance requirements for the trucking industry. Feel free to contact us & be safe.Water Softener Salt Lake City - Water softening involves the removal of cations, namely calcium, manganese, and iron, in hard water. This is often achieved using various resins in order to decrease lime build up, iron staining, soap scum, dry skin, and can extend the life of various plumbing equipment and laundry fabric. The water softener replaces the incoming magnesium and calcium ions with sodium ions or potassium ions, depending on the type of regenerant used, salt (NaCl) or potassium Chloride (KCl).professional plumbing services las vegas - Your search for the best backflow testing services provider ends with Backflow Prevention Services, Inc. in Las Vegas Nevada. Visit our site for more details.Plumber HQ Emergency Plumber Bristol - Emergency plumber Bristol\'s website. If you need a new boiler or need a drain unblocking visit our website, get some information and give us a call!Must Haves on Every Resumes | Resume Writing - Collaberasp is a Leading IT Recruiting, Executive Search Firm, which helps clients achieve and maintain market leadership by helping them hired. CollaberaSP is one of the most prominent IT staffing and IT Recruitment Company in San Francisco and Bay Area. We provide best employment in the technology industries. If you are looking for a good job, then you can contact Collaberasp. Here is an Article on What are the must haves on Every Resumes?
Villa Peyzajı |Otel Peyzajı, tasarım, uygulama - Maxplore | Landscape and Architecture | Turkey Pezage design, Projecting, Application Phase, Consultancy. As Maxp Peyzaj, we carry many years of experience in landscape architecture. We combine your dreams with our designs. We are working for a greener world.Mastering Lighting Techniques for 3D Game Environments - Discover the art of creating captivating 3D game environments through masterful lighting. Learn the art of lighting techniques with Arena Game Design courses.Wearable Air Bag Market size is expected to grow at a CAGR of 8.1% from 2022 to 2030 - According to the Market Statsville Group (MSG), the global wearable airbag market size is expected to grow at a CAGR of 8.1% from 2022 to 2030. Wearable airbags are typically made of nylon, in which, either nitrogen or argon gases are used to inflate the bag. The airbags are equipped with advanced technology which pre-determines the fall and inflates the bag to provide cushion and safety to the user. There are several factors expected to support the market growth globally, such as the...Yardworx - Yardworx provides year-round outdoor services including snow removal services, landscaping, lawn care and lawn maintenance for commercial and residential properties in Calgary, Alberta.Automatic Two Head Volumetric Liquid Filling Machine - Automatic Two Head Volumetric Liquid Bottle Filling Machine Mode: AI-BFM 2 is suitable for Bottles with maximum speed of 60 Bottles per minute. The output of Bottle Filling Machines depending on nature of Liquids, Bottle Diameter, Bottle Height, Bottle Neck Size and Fill Volume.
Recently Active Editors
amarnathansatinavswhitekeyprismwholesneonjest
samkahnksautosqasrjamalkwmokoorganicsriverandsky123
Random Editor

Isha Khan
Top Featured
Add a site
Antisan Yacht - Antisan is 33m motor yacht based in Cannes in the south of France. The yacht is available to charter by the day, week or longer. Antisan sleeps up to 11 guests in 5 cabins. The yacht has a fabulous crew, including an amazing Chef. Unlike other charter yachts, Antisan is not limited to 12 guests when cruising. She is legally allowed to cruise in daylight hours with up to 40 people onboard. This makes Antisan the ideal yacht for day charters for large groups, as well as weddings and...
Antisan Yacht
Antisan is 33m motor yacht based in Cannes in the south of France. The yacht is available to charter by the day, week or longer. Antisan sleeps up to 11 guests in 5 cabins. The yacht has a fabulous crew, including an amazing Chef. Unlike other charter yachts, Antisan is not limited to 12 guests when cruising. She is legally allowed to cruise in daylight hours with up to...
https://bespokeyachtcharter.com/antisan/
Expires on Monday, February 8th, 2044 Sports and Recreation, Boating - More Details
Madison Liquidators - Looking for office furniture for your business or home? Check out Madison Liquidators for an extensive collection of office chairs, desks, conference tables, file cabinets, and much more. Enjoy the convenience of direct shipping to your doorstep.
Madison Liquidators
Looking for office furniture for your business or home? Check out Madison Liquidators for an extensive collection of office chairs, desks, conference tables, file cabinets, and much more. Enjoy the convenience of direct shipping to your doorstep.
https://madisonliquidators.com/
Expires on Tuesday, July 22nd, 2042 Home, Furniture - More Details
MMA Podcast | Coupons - Welcome to our MMA podcast based in Chicago, where we explore the fine line between serious and ridiculous. Join us as we delve into the world of mixed martial arts and share our unique insights and perspectives.
MMA Podcast | Coupons
Welcome to our MMA podcast based in Chicago, where we explore the fine line between serious and ridiculous. Join us as we delve into the world of mixed martial arts and share our unique insights and perspectives.
http://mmanuts.com/
Expires on Saturday, July 27th, 2041 Sports and Recreation, Boxing and MMA - More Details
Comfyhome Heating & Cooling Melbourne - Comfyhome Specialised in gas ducted heating, evaporative cooling, split system and air conditioning installation, service and repairs. ComfyHome adheres to a customer-centric approach in a bid to provide premium heating and cooling solutions that fulfill your needs and align with your budget. We bring you convenience, affordability, and quality of service you won't find anywhere else.
Comfyhome Heating & Cooling Melbourne
Comfyhome Specialised in gas ducted heating, evaporative cooling, split system and air conditioning installation, service and repairs. ComfyHome adheres to a customer-centric approach in a bid to provide premium heating and cooling solutions that fulfill your needs and align with your budget. We bring you convenience, affordability, and quality of service you won't find...
https://www.comfyhome.com.au
Expires on Friday, July 12th, 2041 Home, Heating and Cooling - More Details
Office Furniture - Madison Liquidators is a nationwide distributor of new performance laminate, veneer and solid wood office furniture. Visit us for great deals at liquidation prices!
Office Furniture
Madison Liquidators is a nationwide distributor of new performance laminate, veneer and solid wood office furniture. Visit us for great deals at liquidation prices!
https://www.madisonliquidators.com/office-furniture/
Expires on Wednesday, May 15th, 2041 Home, Furniture - More Details
© 2004-2024 Viesearch. 16 Hudson Ave #3201, Glens Falls, NY 12801   Auctions   Terms   Privacy   RSS