Viesearch
Viesearch - Human Powered Search Engine
590,456,190 Searches  3,383,177 Submissions  860,210 Sites  4,908 Featured  1,083 Categories  326,040 Editors
Newest Featured
Solotica.com is the exclusive online store of the world's most natural color contact lenses. Inspired by the natural beauty of its origin, Brazil, these colored contacts can transform your eye color in an instant with a natural finish.
Maddison Scaffolding Ltd is a top scaffolding company in London, specializing in domestic and residential projects with over 20 years of experience. Our CITB-trained team offers comprehensive services, including planning, design, erection, and dismantling of scaffolding systems, ensuring safety and quality by adhering to British Standards BS 5975. Whether your project...
Bulk Vending World is your one-stop shop for all your bulk vending needs, offering a diverse selection of products ranging from plush toys and bouncy balls to unique candies and temporary tattoos. Our site caters to both casual shoppers and serious bulk buyers, providing detailed product descriptions, easy navigation, and competitive pricing. Whether you're...
Hypnotherapy and Hypnosis website focused on helping people to improve themselves by helping our clients to lose weight, manage anxiety, remove stress, quit smoking, heal from PTSD and trauma as well as getting over fears and helping people to gain confidence in themselves.
we provides high precision parts machining services for the aerospace, marine, energy, automotive, medical and electronics industries worldwide. Choose the best cnc machining china to you.
Recent social activity
AI T-shirt Design Generator submitted a new listing for review
Thursday, May 23rd, 2024 at 3:06am
Fertisperm updated their about me, profile picture, claimed, and status
فيرتي سبيرم: كبسولات فعالة لدعم الخصوبة عند الرجال
Thursday, May 23rd, 2024 at 3:06am
AI T-shirt Design Generator joined the team as a Viesearch editor!
Tech Trends: AI Art Apparel Evolution
Thursday, May 23rd, 2024 at 3:05am
KumarCK activated a new listing for Hospital Management System
Thursday, May 23rd, 2024 at 3:03am
Thursday, May 23rd, 2024 at 3:02am
Recently Viewed Listings
Linux shared web hosting | hosting plan | imaker.biz - Linux Hosting Plans: Cheap Linux Web Hosting Plans for Domain Name Hosting, Domain Name Web Hosting, Web Domain Hosting, PHP Hosting at our website.Reliable Web Hosting | FREE Domain Name | Website Hosting - Looking for free, affordable and reliable web hosting with FREE. Com. Net Domain name? Look no further iWeb4� is the newest and most affordable, shared, cloud, vps and dedicated Website Hosting and Domain name providerPsychologist Kyiv - Anna Borodina is a child and family psychologist. Consultations of a psychologist in Kyiv and online.Oworkers data entry services - We are a BPO services company specialized in data entry outsourcing services, data annotation services and content moderation services  in 20+ languages with multiples delivery centers  in the world (Bulgaria, Madagascar, Egypt, India ..)ESALQ - Food Safety and Engineering - We are a consultancy agency in the area of food, located in Belo Horizonte / MG. We have a team of Food Engineers, always ready to assist your business.
#1 Web Hosting VPS, Linux, Windows Hosting Company, USA - Logelite - Web Hosting Company - Logelite, is fast growing web hosting service provider in USA. We are offering VPS, Linux and Windows hosting at wide range.
Vertex IT Solutions - Chicago area full service IT solutions provider. Vertex is an company providing IT consulting services for Chicago businesses. Contact Vertex 866-970-7803.What happens when you go paperless? - The rising cost of healthcare in the United States is moderately due to its dependence on paper products. According to estimates the healthcare industry spends around $300 billion per year on paper, providing a strong incentive for eliminating this expense. But, if you talk about paperless medical billing process, then one must know that the benefits it provides is greater patient satisfaction, higher retention rates and increased payment rates, especially with online payments. Along with that..Digital Marketing Agency in Egypt | Green Mind - Green Mind Agency is an experienced, full-service digital marketing and creative agency based in Egypt.

We believe in creativity, teamwork, and customization that better suits your needs. No matter what your business is requiring or how big it is, just relax we are here to help you!

We are a group of specialized people that will proactively manage your project from A to Z depending on your demands and budget. Green Mind team will work with you from the beginning and throughout your projectManufacturer & Supplier of Industrial Mopping Machine - Cosmic Healers - We are the Manufacturer & Supplier of a three-wheeled ride-on electric mopping scooter with best-in-class indoor cleaning capability for your industrial needs & can run for eight hours on a four-hour charge time. Contact us for more details.
Recently Active Editors
suvadipchakdarshandentalmydesgnsaroraaromaticspresidecy
kishornexxamiltonkeynesmorrissattiscatapeteaemilyshawn578
Random Editor
Top Featured
Antisan is 33m motor yacht based in Cannes in the south of France. The yacht is available to charter by the day, week or longer. Antisan sleeps up to 11 guests in 5 cabins. The yacht has a fabulous crew, including an amazing Chef. Unlike other charter yachts, Antisan is not limited to 12 guests when cruising. She is legally allowed to cruise in daylight hours with up to...
Looking for office furniture for your business or home? Check out Madison Liquidators for an extensive collection of office chairs, desks, conference tables, file cabinets, and much more. Enjoy the convenience of direct shipping to your doorstep.
Expires on Tuesday, July 22nd, 2042 Home, Furniture - More Details
Welcome to our MMA podcast based in Chicago, where we explore the fine line between serious and ridiculous. Join us as we delve into the world of mixed martial arts and share our unique insights and perspectives.
Expires on Saturday, July 27th, 2041 Sports and Recreation, Boxing and MMA - More Details
Comfyhome Specialised in gas ducted heating, evaporative cooling, split system and air conditioning installation, service and repairs. ComfyHome adheres to a customer-centric approach in a bid to provide premium heating and cooling solutions that fulfill your needs and align with your budget. We bring you convenience, affordability, and quality of service you won't find...
Expires on Friday, July 12th, 2041 Home, Heating and Cooling - More Details
Madison Liquidators is a nationwide distributor of new performance laminate, veneer and solid wood office furniture. Visit us for great deals at liquidation prices!