Viesearch
Join Now  Sign In  
Viesearch - Human Powered Search Engine
585,393,486 Searches  3,368,973 Submissions  861,801 Sites  4,907 Featured  1,083 Categories  321,275 Editors
Arts and Entertainment (79,644)
Animation, Architecture, Art History, 29 More...
Animation, Architecture, Art History, Astrology and Horoscopes, Body Modification, Classical Studies, Comics, Crafts, Dance, Design, Entertainment, Fashion, Graphic Design, Humanities, Humor, Illustration, Literature, Movies, Music, Myths and Folktales, Native and Tribal, Online Writing, Performing Arts, Photography, Radio, Rhetoric, Television, Theatre, Typography, Video, Visual Arts, Writers Resources
Business (97,235)
Agriculture, Bookkeeping and Accounting, Construction, 31 More...
Agriculture, Bookkeeping and Accounting, Construction, Consulting, Cooperatives, Customer Service, Engineering, Event Planning, Freight Brokerage and Transportation, Human Resources, Industrial, Information Services, International Business and Trade, Life Coaching, Locksmiths, Major Companies, Management, Manufacturing, Messengers and Couriers, Mining, Opportunities, Outsourcing, Painting Services, Personal and Virtual Assistants, Point of Sale Hardware and Systems, Private Investigation, Publishing and Printing, Security Services, Small Business, Telecommunications, Transcription Services, Translation Services, Waste Management and Recycling, Work At Home
Computers and Internet (88,486)
Algorithms, Artificial Intelligence, Chats and Forums, 29 More...
Algorithms, Artificial Intelligence, Chats and Forums, Computer Repair, Computer Science, Cyberculture, Data Backup, Data Recovery, Desktop and Mobile Wallpapers, Desktop Publishing, Domain Names, E-Commerce, Freelancers, Hardware, Internet, Mobile Computing, Open Source, Operating Systems, Podcasts, Portal, Programming, Robotics, Search Engines, Security, Social Networking, Software, Systems, Technical Guides and Support, Virtual Reality, Web Design and Development, Web Hosting, Webmaster Resources
Games (7,602)
Board Games, Card Games, Coin-Op, 17 More...
Board Games, Card Games, Coin-Op, Computer Games, Dice, Flash Game Arcades, Hand Games, Hand-Eye Coordination, Miniatures, Mobile Games, Online, Paper and Pencil, Party Games, Play-By-Mail, Puzzles, Roleplaying, Tile Games, Trading Card Games, Video Games, Yard, Deck, and Table Games
Health and Fitness (72,386)
Aging, Allergies, Alternative, 45 More...
Aging, Allergies, Alternative, Anaesthesiology, Animal, Ayurveda, Beauty, Cardiology, Child Health, Chiropractic, Clinical Research, Conditions and Diseases, Cosmetic Surgery, Dental, Dermatology, Diagnostic Imaging, Disabilities, DNA Testing, First Aid, Fitness, Healthcare Industry, Hearing and Audiology, Home Health Care, Homeopathy, Hygiene, Massage Therapy, Medical Billing, Medical Equipment, Medical ID Bracelets, Medicine, Mental Health, Nephrology, Neurology, Nursing, Nutrition, Obstetrics and Gynecology, Oncology, Ophthalmology and Optometry, Orthopedics, Otorhinolaryngology, Pain Management, Physical Therapy, Physiotherapy, Podiatry, Rheumatology, Senior Care, Urology, Weight Loss
Home (110,714)
Apartment Living, Appliance Repair, Asbestos Removal, 42 More...
Apartment Living, Appliance Repair, Asbestos Removal, Bathroom, Carpeting and Flooring, Chimney Cleaning, Cleaning Services, Cooking, Do-It-Yourself, Domestic Services, Electricians, Emergency Preparation, Entertaining, Family, Fences, Furniture, Garage, Heating and Cooling, Home and Office Safety, Home Automation, Home Business, Home Improvement, Home Restoration and Repair, Homemaking, Homeowners, Interior Design, Kitchen, Laundry and Dry Cleaning, Lighting, Packers and Movers, Personal Finance, Personal Organization, Pest Control, Pets, Plumbing, Roofs and Gutters, Rural Living, Security, Seniors, Storage, Swimming Pools and Spas, Tree Cutting and Removal, Urban Living, Windows and Siding, Yard and Garden
Jobs and Employment (6,044)
Accountancy, Administration, Airport, 21 More...
Accountancy, Administration, Airport, Background Screening, Banking, Call Center, Civil Service, Construction, Customer Service, Driving, Fashion Design, Finance, Hospitality, Marketing, Office, Online Jobs, Part Time, Recruitment Agencies, Resume Writing, Retail, Sales, Teaching, Teaching Assistant, Warehouse
Kids and Teens (7,294)
Arts, Babies, Childcare, 6 More...
Arts, Babies, Childcare, People and Society, Pre-School, School Time, Sports and Hobbies, Teen Life, Your Family
Marketing and Advertising (32,628)
Agencies, Banner Exchange, Directories, 12 More...
Agencies, Banner Exchange, Directories, Forum Posting Services, Link Building, Magazine, Newspaper, Outdoor, Pay Per Click, Promotional Products, Search Engine Optimization, Signage, Television, Trade Show Displays, Traffic Exchange
News (20,538)
Current Events, Internet Broadcasts, Journals, 4 More...
Current Events, Internet Broadcasts, Journals, Magazines and E-zines, Newspapers, Television, Weather
Real Estate (29,444)
Apartment Rentals, Appraisers and Consultants, Brokerages, 10 More...
Apartment Rentals, Appraisers and Consultants, Brokerages, Commercial, Coworking and Office Space, Farm Land, For Sale By Owner, Home Inspection, Plots and Land For Sale, Property Management, Realtors, Residential Projects, Timeshare
Reference and Education (76,533)
Advice, Almanacs, Articles, 17 More...
Advice, Almanacs, Articles, Bibliography, Biography, Blogs, College and University, Education and Training, Educational Resources, Encyclopedias, Genealogy, History, Knowledge Management, Libraries, Living History, Maps, Museums, Resources, Thesauri, World Records
Regional (21,738)
Africa, Argentina, Armenia, 39 More...
Africa, Argentina, Armenia, Asia, Australia, Austria, Brazil, Canada, Caribbean, Central America, Croatia, Czech Republic, Denmark, Europe, Finland, Germany, Greece, Hong Kong, India, Indonesia, Ireland, Israel, Italy, Japan, Lithuania, Middle East, Netherlands, New Zealand, North America, Norway, Oceania, Philippines, Polar Regions, Puerto Rico, Russia, Slovakia, South America, Sweden, Taiwan, United Kingdom, United States, Zimbabwe
Science (8,976)
Aerospace and Aeronautics, Astronomy, Biology, 19 More...
Aerospace and Aeronautics, Astronomy, Biology, Chemistry, Conferences, Earth Sciences, Environment and Nature, Geology and Geophysics, Institutions, Instruments and Supplies, Mathematics, Methods and Techniques, Museums, Nanotechnology, News and Media, Physics, Publications, Reference, Renewable Energy, Science in Society, Technology, Wildlife
Shopping (105,490)
Antiques, Appliances, Art Supplies, 22 More...
Antiques, Appliances, Art Supplies, Auctions, Autos, Beauty Products, Books, Classifieds, Clothing and Shoes, Coupons and Deals, Electronics, Flowers, Food and Beverage, Gifts, Glassware, Greeting Cards, Jewelry, Mobile Phones, Motorcycles, Office Products, Sporting Goods, Tickets, Tools and Hardware, Toys, Wholesale
Society (31,090)
Activism, Crime, Death, 26 More...
Activism, Crime, Death, Disabled, Economics, Ethnicity, Folklore, Future, Holidays, Issues, Language and Linguistics, Law, Lifestyle Choices, Men, Military, Organizations, Paranormal, People, Philanthropy, Philosophy, Roads and Highways, Social Sciences, Sociology, Subcultures, Support Groups, Trains and Railroads, Urban Legends, Weddings, Women
Sports and Recreation (24,880)
Archery, Audio and Radio, Aviation, 55 More...
Archery, Audio and Radio, Aviation, Badminton, Baseball, Basketball, Billiards, Birding, Boating, Bowling, Boxing and MMA, Camps, Climbing, Coaching, Collecting, Crafts, Cricket, Cycling, Disabled, Events, Extreme Sports, Fantasy, Fishing, Football, Geocaching, Golf, Hang Gliding, Hockey, Horseracing, Kites, Knives, Lacrosse, Martial Arts, Models, Motorsports, Organizations, Outdoors, Paintball, Parties, People, Rugby, Running, Scouting, Scuba Diving, Skateboarding, Skating, Soccer, Surfing, Swimming, Table Tennis, Team Spirit, Tennis, Theme Parks, Track and Field, Volleyball, Weight Lifting, Winter Sports, Wrestling
Travel (41,079)
Aircraft Charter, Cruises, Hotels and Accomodation, 7 More...
Aircraft Charter, Cruises, Hotels and Accomodation, Limousines, Luggage, Taxis and Chauffeurs, Tours, Travel Agents, Vacation Packages, Vehicle Rental
Currently TrendingMore...
Recent Searches
Newest Featured
Add a site
Dian Surf School Canggu Bali - Surf School Canggu Provide Surf Lesson In Canggu Get Your Surf lesson Canggu With affodable price, We Loacted in Batu Bolong Canggu Bali
Dian Surf School Canggu Bali
Surf School Canggu Provide Surf Lesson In Canggu Get Your Surf lesson Canggu With affodable price, We Loacted in Batu Bolong Canggu Bali
https://diansurfschool.com/ Sports and Recreation, Surfing - More Details
Delhi Oven - Delhi Oven is an authentic Indian restaurant based in Sacramento, CA. Our head chefs offer both North Indian and South Indian dishes, such as butter chicken, chicken tikka masala, dosas, idli, dal makhani, and more.
Delhi Oven
Delhi Oven is an authentic Indian restaurant based in Sacramento, CA. Our head chefs offer both North Indian and South Indian dishes, such as butter chicken, chicken tikka masala, dosas, idli, dal makhani, and more.
https://delhioven.com Shopping, Food and Beverage, Restaurants - More Details
Bradley Nuttall - Bradley Nuttall, nestled in the heart of Christchurch, stands as a beacon of financial wisdom and expertise. With its roots deeply embedded in the picturesque Canterbury region of New Zealand, this boutique financial planning and investment firm is dedicated to offering unparalleled independent and expert advice. Catering primarily to high-net-worth individuals and their families, Bradley Nuttall prides itself on its commitment to total independence and academic rigour.
Bradley Nuttall
Bradley Nuttall, nestled in the heart of Christchurch, stands as a beacon of financial wisdom and expertise. With its roots deeply embedded in the picturesque Canterbury region of New Zealand, this boutique financial planning and investment firm is dedicated to offering unparalleled independent and expert advice. Catering primarily to high-net-worth individuals and their...
https://bnlnelson.co.nz Business, Bookkeeping and Accounting, Accounting Services - More Details
Wondr Productions LLC Videography - Videography services for weddings, business events, family gatherings, elopements, commercials, and much more!
Wondr Productions LLC Videography
Videography services for weddings, business events, family gatherings, elopements, commercials, and much more!
https://wondrproductions.com/ Arts and Entertainment, Video, Production - More Details
Plex Gaming - iGaming Licensing - Banking - Payment Processing - Plex Gaming offers iGaming Licensing, Banking, Advisory, Legal & Company Structuring Solutions. Navigate the iGaming market with confidence.
Plex Gaming - iGaming Licensing - Banking - Payment...
Plex Gaming offers iGaming Licensing, Banking, Advisory, Legal & Company Structuring Solutions. Navigate the iGaming market with confidence.
https://www.plexgaming.com/ Business - More Details
Recent social activity
View more
DigiSME India submitted a new listing for review
Tuesday, April 16th, 2024 at 1:37am
Smile Clinic London activated a new listing for 12 Must-Know Tips for New Invisalign Users
Tuesday, April 16th, 2024 at 1:36am
Alena Mage submitted a new listing for review
Tuesday, April 16th, 2024 at 1:33am
olivia submitted a new listing for review
Tuesday, April 16th, 2024 at 1:32am
Ethan Charlie activated a new listing and submitted a new listing for review
Tuesday, April 16th, 2024 at 1:31am
Recently Viewed Listings
CathrynRussel - With a passion for service in the Triangle area, Haw River Realty is ready to help with your home-buying and selling needs. As a proud member of the EXP Realty family, our team carries the values of hard work, integrity, and outstanding client service into everything we do.Anti birds safety nets - Nobody likes to get woken up by the sound of pigeon battling on their window ledge or seeing winged animals dirty their premises To keep undesirable feathered creatures from infringing your reason we offer you an assortment of nets. These nets are intended to fend off all Anti Birds Nets in Hyderabad without catching or harming them. Hostile to Anti Bird Nets We have a group of master men, prepared and experienced to do a wide range of family just as modern Anti Bird Net Installations. All...12 Must-Know Tips for New Invisalign Users - Considering transforming your smile with invisalign promo London but aren’t sure where to begin? This essential guide covers the 12 most important pointers to smooth your clear aligner treatment from day one.Plumbers Woodville | Best Plumber Woodville by Best Plumbing - If you need skilled plumbers at Woodville call Best Plumbing and Maintenance. We boast a team of highly skilled plumber who can fix any plumbing problem in Woodville.Football Highlight - Daily we publish football (soccer) highlights from the most important football competitions. Videos includes English Premier League, Liga, Italian Serie A, Bundesliga, Champions League, Libertadores, Brasilian championship and many more.
Best Neurologist Hospital in Guntur | Neurology Doctor in Guntur - Best Neurologist in Guntur provides superior Brain Stroke Treatment in Guntur and brain stroke coma treatment lead by Neurology Specialist GunturWebcasting Companies in London, UK - Webstream Communications is among the best webcasting companies based in London, United Kingdom. At Webstream Communications, Our Engineer offers professional webcasting services to our client in the UK.The Embassy Catering - Top Wedding Caterers Delhi NCR - The Embassy Catering has been listed as top wedding caterers in Delhi NCR. Embassy Catering provide the highest quality catering services and has earned numerous awards over the years.Personal injury law firm - Seek the compensation you deserve for your injuries. We handle all cases from auto accidents to work related injury, with a free initial consultation.Professional Catering Service - Nowadays, the industry of catering services has become very cutthroat. You can access thousands of catering companies, these days. However, you should be cautious while choosing a professional catering services provider in order to do food catering and menu catering for your event.
Recently Active Editors
masonllpdigitizingbuddycoffeemachinedrankitpandeylewisdavid11
netmarkservicesferoj1990drrajatguptavivek_developerfyitester
Random Editor

carrieburke web
Top Featured
Add a site
Antisan Yacht - Antisan is 33m motor yacht based in Cannes in the south of France. The yacht is available to charter by the day, week or longer. Antisan sleeps up to 11 guests in 5 cabins. The yacht has a fabulous crew, including an amazing Chef. Unlike other charter yachts, Antisan is not limited to 12 guests when cruising. She is legally allowed to cruise in daylight hours with up to 40 people onboard. This makes Antisan the ideal yacht for day charters for large groups, as well as weddings and...
Antisan Yacht
Antisan is 33m motor yacht based in Cannes in the south of France. The yacht is available to charter by the day, week or longer. Antisan sleeps up to 11 guests in 5 cabins. The yacht has a fabulous crew, including an amazing Chef. Unlike other charter yachts, Antisan is not limited to 12 guests when cruising. She is legally allowed to cruise in daylight hours with up to...
https://bespokeyachtcharter.com/antisan/
Expires on Monday, February 8th, 2044 Sports and Recreation, Boating - More Details
Madison Liquidators - Looking for office furniture for your business or home? Check out Madison Liquidators for an extensive collection of office chairs, desks, conference tables, file cabinets, and much more. Enjoy the convenience of direct shipping to your doorstep.
Madison Liquidators
Looking for office furniture for your business or home? Check out Madison Liquidators for an extensive collection of office chairs, desks, conference tables, file cabinets, and much more. Enjoy the convenience of direct shipping to your doorstep.
https://madisonliquidators.com/
Expires on Tuesday, July 22nd, 2042 Home, Furniture - More Details
MMA Podcast | Coupons - Welcome to our MMA podcast based in Chicago, where we explore the fine line between serious and ridiculous. Join us as we delve into the world of mixed martial arts and share our unique insights and perspectives.
MMA Podcast | Coupons
Welcome to our MMA podcast based in Chicago, where we explore the fine line between serious and ridiculous. Join us as we delve into the world of mixed martial arts and share our unique insights and perspectives.
http://mmanuts.com/
Expires on Saturday, July 27th, 2041 Sports and Recreation, Boxing and MMA - More Details
Comfyhome Heating & Cooling Melbourne - Comfyhome Specialised in gas ducted heating, evaporative cooling, split system and air conditioning installation, service and repairs. ComfyHome adheres to a customer-centric approach in a bid to provide premium heating and cooling solutions that fulfill your needs and align with your budget. We bring you convenience, affordability, and quality of service you won't find anywhere else.
Comfyhome Heating & Cooling Melbourne
Comfyhome Specialised in gas ducted heating, evaporative cooling, split system and air conditioning installation, service and repairs. ComfyHome adheres to a customer-centric approach in a bid to provide premium heating and cooling solutions that fulfill your needs and align with your budget. We bring you convenience, affordability, and quality of service you won't find...
https://www.comfyhome.com.au
Expires on Friday, July 12th, 2041 Home, Heating and Cooling - More Details
Office Furniture - Madison Liquidators is a nationwide distributor of new performance laminate, veneer and solid wood office furniture. Visit us for great deals at liquidation prices!
Office Furniture
Madison Liquidators is a nationwide distributor of new performance laminate, veneer and solid wood office furniture. Visit us for great deals at liquidation prices!
https://www.madisonliquidators.com/office-furniture/
Expires on Wednesday, May 15th, 2041 Home, Furniture - More Details
© 2004-2024 Viesearch. 16 Hudson Ave #3201, Glens Falls, NY 12801   Auctions   Terms   Privacy   RSS