Viesearch
Viesearch - Human Powered Search Engine
585,812,722 Searches  3,370,557 Submissions  862,474 Sites  4,904 Featured  1,083 Categories  321,851 Editors
Recent Searches
Newest Featured
My Canberra Building Inspections ACT is a building inspection service in Canberra, Australia. We do residential inspections - all kinds, houses, units, townhouses as well as commercial inspections. Contact us today. We also do inspections of buildings as they are being constructed. We call those staged inspections.
This esteemed landscape construction company specializes in both landscaping design and construction, offering a comprehensive suite of services tailored to enhance outdoor living spaces. Based in Mt. Prospect, IL, and serving surrounding areas, the landscapers team combines innovative design with meticulous construction techniques to transform backyards into picturesque...
We are a fast reliable 24-hour family-run company all glazing repairs are dealt with, quickly and efficiently. We have skills and manpower to deal with any job Swift Glazing have a long history of helping domestic and commercial clients with a host of glazing services, including fitting, repair, and replacement. We cover the whole of London and Greater London too.
Carolina Home Cash Offer is a reliable cash homebuying company based off of Charlotte, NC. Our quick and reliable homebuying solutions is what you're looking for!
Surf School Canggu Provide Surf Lesson In Canggu Get Your Surf lesson Canggu With affodable price, We Loacted in Batu Bolong Canggu Bali
Recent social activity
Akshay activated a new listing and submitted a new listing for review
Friday, April 19th, 2024 at 1:04pm
Exquisite Kitchens activated a new listing and submitted a new listing for review
Friday, April 19th, 2024 at 12:58pm
Brian activated a new listing and submitted a new listing for review
Friday, April 19th, 2024 at 12:44pm
Brian activated a new listing and submitted a new listing for review
Friday, April 19th, 2024 at 12:43pm
Matt D. Burditt submitted a new listing for review
Friday, April 19th, 2024 at 12:37pm
Recently Viewed Listings
Compare PA Electric Rates - Visit us to find comprehensive list of electric supplier plans and rate information so you can choose the best option for you.ISO 27001 Certification in USA - ISO/IEC 27001 is the international standard for providing requirements for an information security management system (ISMS), ISO 27001 consist of 18 Domain which have 114 security controls which ensures Information Security. It derived from a suite of ISO 27000 family. If you looking for ISO 27001 certification in USA. You are at right place.Exotic Travel Club - Exotic Travel Club is a vacations and destination specialist who make your vacations ideal!! With an experience of more than a decade and agility over destinations, we bring to you some of the finest of all vacations you have never experienced before!

At Exotic Travels, we aim to escape you out from the world of stress and tensions, worries and pressures into a whole new world of recreation, leisure, luxury and enjoyment.Boulez-Vous - Event management company organizing all types of boules and petanque events. UK-based.How to Build a Custom CRM Software for Enterprises - Here you can know the types and features of CRM Software. Create high-end custom CRM solutions that are crafted according to your business specifications.
Kestorke Caputre Tool - Kestorke Caputre Tool everything which is entered from the keyboard. Keylogger installation of this utility does not slow the speed of your computer. PC Monitoring Tool is virus free utility. Save logs as in a pdf,  even you can get logs mail in PDF format. Computer spying can send report on Email. MP Supplements - MPSUPPS - Gym supplements online - Harlow Gym - Harlow gym supplements. Free Delivery on order over £20.Locksmith Puyallup, WA | 253-561-0358 | Mobile Locksmith - Locks require to be made by professionals and this is something that we will assist you through as the Locksmith Puyallup company Do not suffer from lack of better locks. Call NowKnee replacement - KRISHNA Heart and Super Specialty Institute - Krishna Heart and Super Speciality Institute is one of the leading heart institutes in India providing open heart surgery,  cardiothoracic surgery,  heart treatments,  Heart valve repair and replacement surgery and other major surgery treatments provided by the hospital.CONSTANT - Since 2004 our company has been producing and supplying polyester swimming pools and swimming pool covers under its own flag on the markets of various countries - both within the European Union and in Eastern European countries (Russia, Ukraine). We also guarantee essential accessories that ensure that the pool functions properly. Every year we sell over 3000 swimming pools and over 1000 canopies.
Recently Active Editors
abcstudylinkspalmmassagrehmantravelslotuscontainerstechnext2012
bookpublishersmarkmiller97568optittecheducationvibes0gclassdrivers
Random Editor
Top Featured
Antisan is 33m motor yacht based in Cannes in the south of France. The yacht is available to charter by the day, week or longer. Antisan sleeps up to 11 guests in 5 cabins. The yacht has a fabulous crew, including an amazing Chef. Unlike other charter yachts, Antisan is not limited to 12 guests when cruising. She is legally allowed to cruise in daylight hours with up to...
Looking for office furniture for your business or home? Check out Madison Liquidators for an extensive collection of office chairs, desks, conference tables, file cabinets, and much more. Enjoy the convenience of direct shipping to your doorstep.
Expires on Tuesday, July 22nd, 2042 Home, Furniture - More Details
Welcome to our MMA podcast based in Chicago, where we explore the fine line between serious and ridiculous. Join us as we delve into the world of mixed martial arts and share our unique insights and perspectives.
Expires on Saturday, July 27th, 2041 Sports and Recreation, Boxing and MMA - More Details
Comfyhome Specialised in gas ducted heating, evaporative cooling, split system and air conditioning installation, service and repairs. ComfyHome adheres to a customer-centric approach in a bid to provide premium heating and cooling solutions that fulfill your needs and align with your budget. We bring you convenience, affordability, and quality of service you won't find...
Expires on Friday, July 12th, 2041 Home, Heating and Cooling - More Details
Madison Liquidators is a nationwide distributor of new performance laminate, veneer and solid wood office furniture. Visit us for great deals at liquidation prices!